Ry x Lv39 hybrids. 1 2 3 4. Ry Lv - 1Kb Bp. 1000. 5. 1000. 500. FL9D. 10. FL9D. E2. FL9D. F6. FL13D. 6. FL13D. 8. FL13E3. FL13E6. FL13F8. Lv. Fn. Fn x Lv39 ...
Figure S4. TCF21, AHR, and ARNT co-expression moduls build a strong interconnected network of genes. Co-expression modules of TCF21 and AHR-ARNT ...
Dec 16, 2015 - when HeLa and RAW cells were infected, RhoA, Rac1 and mDia1 were recruited to mem- brane cell fractions. Our results suggest that the ...
ATACâseq summits (x103). HNF1B PWM count density. ATAC-SEQ/HNF1B. Figure S7. Control PWM correlations show absence of collocalization genome wide.
StrPurNRI. LotGigNRI2. Nem VecNR5. TriA dhHNF4. AmpQueNR2. 1a.7%. SubDom RXR. AmpQueNRI. StrPurNR14. 18. I. 1&I. Drom el PNR. 1.04/199. II/067.
B. VFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV. TRAF6. TRAF2/3. Box2. mT6. mT23.
S3 Fig. Comparison with the structure of MERS-CoV Mpro with that of SARS-. CoV Mpro (A) and those of ligand-bound complex, dimeric C148A mutant and bat-.
S2 Fig. Histological phenotype of thymus of Foxn1-Cre::stat3f/+ mice was indistinguishable from that of Stat3-f/f mice. Immunohistology of cTECs (K8; red) and ...
S3 Fig: Inhibition of ERK½ phosphorylation by U0126. Representative blots showing effect of U0126 pre-treatment on phosphorylation of ERK½ with or without ...
S3 Fig. Virtual cut through an array of helical (or sinusoidal) tubules obtained through a series of successive cuts through individual tubules. Simulation of the.
(B) Predicted folding structure of PMT1 UTR. The RNAfold ... Nucleotide positions are numbered from the UTR 5´-end as in B. UTR, no RNase. (lane 1); UTR ...
biosynthetic nitrogen acetyl-CoA nucleotide acid metabolic primary nucleotide. Hold catabolic biosynthetic purine. Compound process catabolic blosynthetic.
h % a N * *. 8 % x. a a x %. S6||. Extracellular. AIP IR TIE IR AIR. E1308D. T1250M. |. R28C. Intracellular. 2 NH3+. R27T. R5422. CO2. T1174S. R1928G. R604H.
