HERC5 (NP_057407, 915 a.a. - 1025 a.a.) partial recombinant protein with a ~
26kD N-terminal GST tag. Immunogen. This protein is not active and should not ...
Product Datasheet Recombinant Human HERC5 Protein H00051191-Q01-2ug Unit Size: 2 ug Store at -80C. Avoid freeze-thaw cycles.
Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/H00051191-Q01 Updated 11/28/2017 v.20.1
Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/H00051191-Q01
Page 1 of 2 v.20.1 Updated 11/28/2017
H00051191-Q01-2ug Recombinant Human HERC5 Protein Product Information Unit Size
2 ug
Concentration Storage
Please see the vial label for concentration. If unlisted please contact technical services. Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Product Description Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 915-1024 of Human HERC5 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQM KDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNR GFG
Gene ID
51191
Gene Symbol
HERC5
Species
Human
Reactivity Notes
Human
Preparation Method
in vitro wheat germ expression system
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Product Application Details Applications
Western Blot, ELISA, Protein Array
Recommended Dilutions
Western Blot, ELISA, Protein Array
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Novus Biologicals USA
Novus Biologicals Canada
8100 Southpark Way, A-8 Littleton, CO 80120 USA Phone: 303.730.1950 Toll Free: 1.888.506.6887 Fax: 303.730.1966
[email protected]
461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: 905.827.6400 Toll Free: 855.668.8722 Fax: 905.827.6402
[email protected]
Novus Biologicals Europe
General Contact Information
19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) 1235 529449 Free Phone: 0800 37 34 15 Fax: (44) (0) 1235 533420
[email protected]
www.novusbio.com Technical Support:
[email protected] Orders:
[email protected] General:
[email protected]
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt. For more information on our 100% guarantee, please visit www.novusbio.com/guarantee Earn gift cards/discounts by submitting a review: www.novusbio.com/reviews/submit/H00051191-Q01 Earn gift cards/discounts by submitting a publication using this product: www.novusbio.com/publications
