KX679576 Middle East Asia Minor2 Karbala.pdf

5 downloads 0 Views 104KB Size Report
Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha;. Aleyrodiformes; Aleyrodoidea; Aleyrodidae; Aleyrodinae; Bemisia. REFERENCE 1 (bases 1 to ...

Bemisia tabaci isolate KA2_5 cytochrome oxidase subunit I (COI) gene, - Nucleotide ... Page 1 of 2



Nucleotide

GI numbers will no longer display by default on or soon after October 18. Read more.

GenBank

Bemisia tabaci isolate KA2_5 cytochrome oxidase subunit I (COI) gene, partial cds; mitochondrial GenBank: KX679576.1 FASTA

Graphics

Go to: LOCUS DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM

REFERENCE AUTHORS TITLE JOURNAL REFERENCE AUTHORS TITLE JOURNAL COMMENT

FEATURES

KX679576 799 bp DNA linear INV 18-OCT-2016 Bemisia tabaci isolate KA2_5 cytochrome oxidase subunit I (COI) gene, partial cds; mitochondrial. KX679576 KX679576.1 . mitochondrion Bemisia tabaci Bemisia tabaci Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Aleyrodiformes; Aleyrodoidea; Aleyrodidae; Aleyrodinae; Bemisia. 1 (bases 1 to 799) Kareem,A.A., Port,G. and Wolff,K. Mitochondrial, endosymbionts diversity and population structure of sweet potato Bemisia tabaci whitefly reveal novel invasion in Iraq Unpublished 2 (bases 1 to 799) Kareem,A.A., Port,G. and Wolff,K. Direct Submission Submitted (08-AUG-2016) School of Biology, Newcastle University, Percy Street, Newcastle Upon Tyne NE1 7RU, United Kingdom ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## Location/Qualifiers

source

1..799 /organism="Bemisia tabaci" /organelle="mitochondrion" /mol_type="genomic DNA" /isolate="KA2_5" /host="Solanum lycopersicum (tomato)" /db_xref="taxon:7038" /sex="female" /country="Iraq: Kerbala" /collection_date="2015" /collected_by="Aqeel Al-Abedy" /note="biotype: Middle East-Asia Minor2; PCR_primers=fwd_name: C1-J-2195, rev_name: tRNA-1576"

gene

799 /gene="COI"

CDS

799 /gene="COI" /codon_start=1 /transl_table=5 /product="cytochrome oxidase subunit I" /protein_id="AOW43524.1" /translation="VSHLISSEAGKLEVFGSLGMIYAMLTIGILGFIVWGHHMFTVGM DVDTRAYFTSATMIIAVPTGIKIFSWLATLGGMKSNKFSPLGLWFTGFLFLFTMGGLT GIILGNSSVDVCLHDTYFVVAHFHYVLSMGIIFAIVGGVIYWFPLILGLTLNNYSLVS QFYIMFIGVNLTFFPQHFLGLGGMPRRYSDYADCYLVWNKISSAGSILSIISVIYFLF IVLESFLLLRLVSFKLGVSSHLEWKINKPALNHSFKELCLTFFSNVAE"

ORIGIN 1 61 121 181 241 301 361 421 481 541 601

gtttctcatc atttatgcta acagttggaa gttcccacag aaattcaggc ttaactggaa gttgttgcac gttatttatt caattttata ttggggggaa atttcttctg

taatcagcag tattgactat tagatgtaga gaattaaaat ctcttggcct ttattcttgg attttcatta gatttccatt tcatgtttat tgcctcgccg cgggaaggat

tgaggctgga tggcatctta tactcgagct ttttagttgg ttgatttaca caattcttct tgttttatca aatcttgggt tggagtaaat atattcagat tttgagtatt

aaattagagg ggatttattg tatttcactt cttgctactt ggatttttat gtagatgtgt ataggaatta ttaaccttaa ttaacttttt tatgctgatt atttctgtta

tatttggaag tttgaggtca cagctactat tgggtggaat ttttatttac gtttgcatga tttttgctat ataactatag ttcctcagca gttatctagt tttatttttt

https://www.ncbi.nlm.nih.gov/nuccore/KX679576

gttgggtata tcatatattt gattattgct aaagtctaat tataggcgga cacttatttt tgtgggagga attggtgtct tttccttggt atgaaataaa atttattgtt

20/10/2016

Bemisia tabaci isolate KA2_5 cytochrome oxidase subunit I (COI) gene, - Nucleotide ... Page 2 of 2

661 ttagaatctt ttcttcttct gcgtttagta agatttaagc ttggtgtaag cagacatcta 721 gaatgaaaaa ttaataaacc agctcttaat cacagtttca aagagctgtg tttaactttt 781 ttttctaatg tggcagaaa //

https://www.ncbi.nlm.nih.gov/nuccore/KX679576

20/10/2016