Mathematics - Pearson Schools

Mathematics

2011

www.pearsonschoolsandfecolleges.co.uk

Contents

5 great ways to save

11–14 Level Up Maths ............................................................... 1–7 Exploring Maths ............................................................ 8–13

when you order online at www.pearsonschoolsandfecolleges.co.uk

14–16 Edexcel GCSE Mathematics 2010 ................................ 14–27 Edexcel Functional Skills Mathematics 2010................. 28–29 AQA GCSE Mathematics 2010 ..................................... 30–38 AQA Functional Skills Mathematics 2010 ..................... 39–41 IGCSE Mathematics..................................................... 42–43 Edexcel GCSE Statistics ............................................... 44–46 Edexcel GCSE Mathematics 2006 ...................................... 47 Heinemann Edexcel GCSE ................................................. 48 Longman AQA GCSE Mathematics 2006 ............................ 49

16+ Edexcel AS and A Level Modular Mathematics .............. 50–55 Longman Advanced Mathematics....................................... 56 Advancing Maths for AQA .................................................. 57

SCOTLAND Heinemann Higher Mathematics ........................................ 58 Scottish Secondary Mathematics ....................................... 59

Save money – a spectacular 15% discount on all online orders over £200.

Save time – with our online Fast Shop you just type in your ISBNs and away you go.

Save hassle – choose to use your credit/debit card or even order on your educational establishment account and receive an invoice with your order.

Save queries – type in your purchase order number when placing your order and we’ll include it on your invoice. Save phone calls – track your orders online in MyAccount.

INTERNATIONAL Pearson Baccalaureate Mathematics.................................. 60

Bringing together an unbeatable range of teaching, learning and assessment resources from the well-known names of Heinemann and Longman. Also features Edexcel’s own resources to provide even greater flexibility and choice.

Cover image credit: Shutterstock/ Miao Liao

Look out for the logos at the top of each page as a guide!

Talk to us before you buy 0845 630 33 33

@

0845 630 77 77

[email protected] www.pearsonschoolsandfecolleges.co.uk

Maths 11–14

An inspirational Key Stage 3 course for today’s 11–14 classroom!

Packed with engaging activities and comprehensive lesson plans to support you in your teaching, this fantastic series makes learning maths fun and progression easy.

O Ensure clear progression

O Make maths engaging

with levelled and sublevelled questions.

O Functional skills embedded

and fun with activities and games!

O Improve results and raise

throughout.

attainment. Level Up supports targeted teaching for all abilities.

Level Up course structure Lower attainers – Years 7, 8, 9

Middle to Higher attainers – Years 7, 8, 9

High attainers – Years 7, 8, 9

Access Book and Access Teacher Planning & Assessment Pack with editable CD-ROM

Pupil Book, Teacher Planning & Assessment Pack with editable CD-ROM, Homework Book with LiveText Pupil CD-ROM, and LiveText Whiteboard CD-ROM

Online Assessment – Years 7, 8, 9

Matched to the 2008 Key Stage 3 Programme of Study.

1 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]

w www.pearsonschoolsandfecolleges.co.uk

Maths 11–14

See Level Up Maths in action! Find out how one school is having huge success with Level Up Maths

Wheelers Lane is a newly-built state-of-the-art boys technology college in Birmingham. We asked the teachers and pupils to give their verdict on what difference Level Up Maths is making to their Maths lessons... Ensures clear progression “The pupils absolutely love being able to identify the levels in the books and the crucial part is that the books have been sub-levelled as well as levelled.”

Activities and games make maths engaging and fun “LiveText has had a huge impact and we use it all the time. You can flash up individual questions on the interactive whiteboard that a group of pupils might be struggling with, zoom in on that question and work through it as a class.”

www. Level Up Maths in action! Watch the video of teachers at Wheelers Lane talking about their experience with Level Up Maths at: www.pearsonschools. co.uk/levelupmathscasestudy.

2

Teacher support and online assessment to help you get accurate results “We use the Teacher Planning and Assessment Packs to help with planning. The packs provide even the basics such as helping with starter sentences, introducing topics and what pointers you need to make pupils aware of.”

Functional Skills embedded throughout “The Level Up Maths scheme of work integrates Functional Skills throughout and introduces our pupils to it gradually from Year 7, so that when they get to GCSE it won’t be a whole new concept for them to learn.”

Improves results and raises attainment “Attainment has been consistent with other schools and for our school has improved significantly. The number of Level 7s we now get in Year 8 is far higher than it was before.”

“It’s not boring maths, lessons are fun and enjoyable. Every day we learn something new.” Year 7 Pupil

Maths 11–14

Pupil Books Motivate your pupils to progress Ensuring clear progression for every pupil, these textbooks feature a wealth of activities that make progression easy and help you deliver personalised lessons. Plenaries at the end of each unit contain exercises that develop Functional Skills and put maths in a real-world context.

“The new course is brilliant. It is much better than the old textbooks because they stand out more and are much more fun” Pupil, Matravers School, Wiltshire

Pupil Book

Levelled and sub-levelled questions provide clear differentiation and progression.

‘Why learn this?’ sections relate maths to the real world.

Bright and innovative design that pupils love.

Sample pages from Level Up Maths: Pupil Book 4–6

Stimulating, fun and exciting activities provide a memorable learning experience.

Sample pages from Level Up Maths: Pupil Book 3–5

3 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 11–14

Access Workbooks Support for your lower attainers These Access Workbooks will fully support your lower-ability pupils, allowing them to work at their own level, from Level 1 upwards. Each book is linked to the corresponding core Pupil Book, enabling lowerattaining pupils to receive the full range of support and extension they need.

Access Workbook Fun activities appeal to lower attainers.

Write-in format allows pupils to engage with learning.

Colourful and ‘clutter-free’ presentation stimulates pupils.

Sample page from Level Up Maths: Access Workbook Levels 1–2

Homework Books

Levels

5-7

Practise their skills! MATHS

Featuring a wealth of differentiated practice questions and activities, these colourful Homework Books contain: O a homework exercise for every lesson in the Pupil Book, to consolidate learning

&'520 ,16,'(

O levelled and sub-levelled questions, to make it easier to set homework at the right level O FREE LiveText CD-ROM.

“Level Up Maths tells you what you need to do to get good levels such as 5s and 6s.” Pupil, Cardinal Newman School, Coventry

FREE

Live Te cont xt CD-R • the Pu aining OM pi

l Boo • in • audio teractive ex k on screen plan glos • comp sary in 5 lanations etiti

ve g

4

guag

ame

s

es

Maths 11–14

Teacher Planning and Assessment Packs

Levels

6-8

Easy to use for targeted teaching

MATHS

Fully customisable, these comprehensive Teacher Planning and Assessment Packs feature clearly highlighted objectives and detailed plans to help you deliver the Programme of Study and renewed Framework effectively.

PLANNING & ASSESSMENT PACK

CD-ROM INSIDE

O Pupil Book pages are reproduced for easy reference.

For standalone and VLE use

O Common difficulties are highlighted, with suggestions on how to help pupils progress.

www.

O Detailed plans for the starter, main teaching and plenary provide focused teaching.

For free schemes of work and opportunities for assessing key indicators visit: www.pearsonschools.co/uk/ levelupsupport.

O Specially designed for skim-reading, so you can get the ideas you want – fast!

Functional Skills are identified for every lesson, giving you the confidence to know you are delivering key requirements of the renewed Framework.

Teacher Planning and Assessment Pack

Sample pages from Level Up Maths: Teacher Planning and Assessment Pack Levels 4–6

Clear referencing of process skills helps you identify which areas of the Programme of Study and Framework you are covering in your lessons.

Links to intervention resources enable you to help those pupils that need extra support.

Answers to every question in the Pupil Book allow you to mark the exercises set easily.

5 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 11–14

LiveText Whiteboard Software Helps to make maths relevant, engaging and fun! Hosting digital versions of the Pupil Books for whole-class teaching, LiveText features additional assets, fun activities to engage your pupils and resources to support your lessons. O Lesson plans, activity notes and assessment questions give you flexibility and choice in your

lesson planning. O Explanations of key concepts and worked solutions help you explain those tricky topics. O Audio glossary in five different languages supports pupils from different cultures. O Stimulating, fun and exciting ‘World’s Greatest Maths’ lessons and ‘y Maths’ activities

consolidate learning. O 1000 extra sub-levelled questions provide further support, practice and extension.

LiveText Whiteboard CD-ROM Enlarge and project every part of the Pupil Book page for focused, whole-class teaching.

Hotspots provide direct access to explanations, extra questions and further interactive maths tools.

Sample screenshot from Level Up Maths: LiveText Whiteboard CD-ROM Levels 4–6

Try LiveText View the demonstration online at: www.pearsonschools.co.uk/ levelupmathslivetextdemo.

Resource Bank provides extended tasks, ‘Use It’ activities, competitive games and much more for flexibility and choice in your lesson planning.

Activities with stunning graphics, design and presentation entertain and captivate pupils. Sample screenshot from Level Up Maths: LiveText Whiteboard CD-ROM Levels 4–6

6

Maths 11–14

Online Assessment Monitor and assess your pupils’ progress Fully supporting Assessing Pupils’ Progress (APP), this online assessment tool is specifically designed to help you monitor the progress of your pupils. O Bright and clear interactive questions engage pupils during the assessments. O Summative tests monitor pupils’ ongoing progress and provide a ‘snapshot’ of performance covering

a range of levels. O Diagnostic assessments identify barriers to learning and give detailed feedback on pupils’

performance. O Pupil and teacher reports provide feedback on what pupils need to know and what they need to do

to progress. O Graphics and charts provide a visual representation of levels achieved.

“This is fab because you can do it in your own time and you’re not pressurised into answering all the questions at once.” Pupil, Matravers School, Wiltshire

order and evaluate Evaluate Each Level Up Maths Evaluation Pack contains:

Level Up Maths Teacher Planning and Assessment Pack with editable CD-ROM

– a FREE Pupil Book – Teacher Planning and Assessment Pack

Levels 1–2 Access Teacher Planning and Assessment Pack 978 0 435537 26 5 £110.00 Levels 2–3 Access Teacher Planning and Assessment Pack 978 0 435537 27 2 £110.00

Evaluation Pack 1 (Levels 3–5) 978 0 435047 98 6 £110.00

Levels 3–4 Access Teacher Planning and Assessment Pack 978 0 435537 28 9 £110.00

Evaluation Pack 2 (Levels 4–6) 978 0 435047 99 3 £110.00

Levels 3–5 Teacher Planning and Assessment Pack 978 0 435537 65 4 £110.00

Evaluation Pack 3 (Levels 5–7) 978 0 435047 05 1 £110.00 Evaluation Pack 4 (Levels 6–8) 978 0 435048 07 5 £110.00

Order Level Up Maths Pupil Books Levels 1–2 Access Book 978 0 435537 42 5 £ 6.75 Levels 2–3 Access Book 978 0 435537 43 2 £ 6.75 Levels 3–4 Access Book 978 0 435537 44 9 £ 6.75 Levels 3–5 Pupil Book 978 0 435537 30 2 £12.99 Levels 4–6 Pupil Book 978 0 435537 31 9 £12.99 Levels 5–7 Pupil Book 978 0 435537 32 6 £12.99

Level Up Maths LiveText Whiteboard CD-ROM Levels 3–5 LiveText Whiteboard CD-ROM 978 0 435537 45 6 £425.00* (+VAT) Levels 4–6 LiveText Whiteboard CD-ROM 978 0 435537 46 3 £425.00* (+VAT) Levels 5–7 LiveText Whiteboard CD-ROM 978 0 435537 47 0 £425.00* (+VAT) Levels 6–8 LiveText Whiteboard CD-ROM 978 0 435537 48 7 £425.00* (+VAT)

Level Up Maths Online Assessment


Year 7 1 yr Online Assessment Initial Subscription 978 0 435537 55 5 £255.00 (+VAT)





Level Up Maths Homework Book with LiveText Pupil CD-ROM


Levels 3–5 Homework Book 978 0 435537 38 8 £4.60





Year 9 1 yr Online Assessment 978 0 435537 57 9 £255.00 (+VAT)


Year 9 2 yr Online Assessment Initial Subscription 978 0 435537 62 3 £410.00 (+VAT) Year 9 3 yr Online Assessment Initial Subscription 978 0 435537 63 0 £560.00 (+VAT)

Levels 6–8 Pupil Book 978 0 435537 33 3 £12.99

* This product contains a component which is designed to run in a SCORM-compliant VLE. For further details, please contact Technical Support on 0845 313 88 88.

www. For free resources, games and samples please visit: www.pearsonschools.co.uk/ levelupsupport.

7 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 11–14

Ensure two levels of progress with Anita Straker and her team!

Exploring maths provides comprehensive resources and opportunities for self-assessment that ensure all pupils make two levels of progress whatever their ability.

O Rigorous assessment

O Specific Functional Skills

throughout, with paper tests and online diagnostic assessment from

O Written for the renewed

O Powerful, interactive

2008 Mathematics Framework so you can be completely confident that the new objectives are covered.

toolset available on ActiveTeach to help you teach all topics at Key Stage 3.

activities for process skills in every tier.

course structure

8

NC levels 2–3

NC levels 3–4

NC levels 4–5

NC levels 5–6

NC levels 5–6

NC levels 6–7

NC levels 7–8

(mainly level 3)

(mainly level 4)

(both levels 4 & 5)

(mainly level 5)

(mainly level 6)

(mainly level 7)

(mainly level 8)

Extra Support

Support

Core

Extension

Gifted & Talented

Extra Support

Support

Core

Extension

Gifted & Talented

Extra Support

Support

Core

Extension

Gifted & Talented

Excellent preparation for GCSE.

Maths 11–14

ActiveTeach The ultimate front-of-class teaching tool ActiveTeach is a powerful electronic learning resource combining innovative teaching materials with the flexibility to introduce your own resources – providing you with the perfect solution for seamless lesson planning and whole-class teaching.

ActiveTeach

Import your own resources into ActiveTeach to use alongside the rich bank already provided.

Sample screen from Exploring Maths ActiveTeach

Instant access to a wealth of digital tools and resources, all of which open directly from the page.

Animations help to illustrate new and challenging concepts.

www. View a walkthrough of ActiveTeach and more sample material at: www.pearsonschools.co.uk/ exploringmathsdemo.

Sample screens from Exploring Maths ActiveTeach

9 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 11–14

Teacher Books Exceptional support for the whole department O Over 100 hours of lessons per tier ensure there is plenty of material to use in a SAT-free world. O Detailed lesson notes are great for planning and provide in-depth support for non-specialist teachers. O Each tier has over 20 Check Up and Mental Tests with levelled questions, providing rigorous

assessment support. O Functional Skills objectives are easy to find. O A pathway for teaching a condensed Key Stage 3 is provided.

Teacher’s Book

Content, Process and Functional Skills objectives for each unit. Outlines the main learning points, so it is clear what pupils should know by the end of the lesson.

Sample pages from Exploring Maths Tier 3 Teacher’s Book

Outlines Assessment for Learning opportunities.

Icons show where ICT can be integrated into the lesson.

www. Free Samples! www.pearsonschools.co.uk/ tryexploringmaths.

Pre-set tools to use with the class.

“Exciting, well presented and covering all aspects and levels I could want at KS3.” Mrs Newell, The River School, Worcester

Check Up and Resource sheets are ideal to use as handouts.

FREE

CD-R

OM c

• check notes • menta up tests

• res l test • slides ource sheets and

10

onta

• lesson

s ers

answ

ining

Maths 11–14

Class Books Strengthen pupils’ understanding The Exploring maths Class Books are organised into units to accompany the Teacher’s Book and are designed to help strengthen pupils’ understanding.

“I have been genuinely impressed by the content and quality of the books.” Mrs S. Jordan, Head of Maths, The Middlecott School, Boston, Lincs

Class Book Worked examples at the beginning of each lesson help pupils work independently. ‘How well are you doing?’ levelled self-assessment tests help pupils see what they need to do to improve and you to assess the objectives taught within the unit.

Specific Functional Skills tasks focus on the important process skills.

Three levels of differentiation in each exercise help pitch work to the right level and match pupil understanding.

Sample page from Exploring Maths Tier 3 Class Book



Watch Anita Straker talk thorough the course! www.pearsonschools.co.uk/exploringmathsdemo

11 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 11–14

Home Books Consolidating pupils’ learning Home Book Each lesson has a homework task reinforcing what has been taught in class.

The Home Book supports and consolidates the work carried out in class.

Accessible language ensures that pupils can work without adult support.

A

Linear graphs and inequalities

6.2

TASK 1: Sketching and drawing linear graphs Points to remember The normal form of a linear equation is y ⫽ ax ⫹ b.

Each homework task reminds pupils what they have learned in the lesson, so that they can apply it to the questions.

The graph of the equation y ⫽ ax ⫹ b has gradient a and intercept on the y-axis at (0, b). When you sketch a linear graph, label the axes and mark the origin and the intercept on the y-axis. To make an accurate drawing of a linear graph, calculate the coordinates of three points, plot them and draw a line through them using a ruler and sharp pencil.

Sample page from Exploring Maths Tier 2 Home Book You need some graph paper, a ruler and pencil.

1

2

Write the gradient and intercept for the graphs of these equations. Sketch the graphs. Use a new grid for each graph. a y ⫽ x ⫹ 14

b y⫽x⫺9

c y ⫽ 4x ⫺ 2

d y ⫽ 2x ⫹ 11

e y ⫽ ⫺2x

f y ⫽ ⫺0.5x ⫹ 3

Rearrange these equations into their normal form, and write the gradient and intercept. Sketch the graphs. Use a new grid for each graph. a y ⫺ x ⫽ 10

3

b y⫹x⫽7

On graph paper, make an accurate drawing of the graph of y ⫺ 2x ⫽ 5.

A6.2 Linear graphs and inequalities | 31

Sample page from Exploring Maths Tier 6 Home Book

A handy ‘Points to remember’ section reminds pupils about important points so mistakes are less likely. Worked examples are a useful reminder for pupils before they tackle their homework task.

12

Sample page from Exploring Maths Tier 3 Home Book

Maths 11–14

”We very much like the fact that the books don’t refer to year groups – a key factor in deciding to buy.” Mrs H. Lawrence, Head of Maths, Ash Green School and Arts College, Coventry

order and evaluate evaluate Each Exploring Maths Evaluation Pack contains the Class Book

Exploring maths: Tier 5 Homework Book 978 1 405844 20 8 £5.75 Exploring maths: Tier 6 Homework Book 978 1 405844 24 6 £5.75

Tier 2 Evaluation Pack 978 1 408257 80 7 £14.99

Exploring maths: Tier 7 Homework Book 978 1 405844 23 9 £5.75

Tier 4 Evaluation Pack 978 1 408257 81 4 £14.99

Teacher Books

Tier 6 Evaluation Pack 978 1 408257 82 1 4 £14.99

Exploring maths: Tier 1 Teacher’s book 978 1 405844 15 4 £87.50

order Classbooks

Exploring maths: Tier 2 Teacher’s book 978 1 405844 07 9 £87.50 Exploring maths: Tier 3 Teacher’s book 978 1 405896 09 2 £87.50

Exploring maths: Tier 1 Class Book 978 1 05844 04 8 £14.99




Exploring maths: Tier 3 Class Book 978 1405844 11 6 £14.99





ActiveTeach


Exploring maths: Tier 1 ActiveTeach 978 1 405844 26 0 £310.00 (+VAT)



Homework Books










”Exploring Maths has prepared our pupils with the key topics required at Key Stage 3. The tiered books use a ‘stage’ not ‘age’ approach which has really suited our needs here at Longfield, ensuring all levels of pupils are catered for.” Mr S Gregory, Head of Mathematics, Longfield School – a specialist college

To see an interactive demo of Exploring Maths visit: www.pearsonschools.co.uk/exploringmathsdemo.

13 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Edexcel GCSE Mathematics new! Your proven formula for success

Edexcel’s own course for GCSE 2010 Mathematics provides support for both specifications A (Linear) and B (Modular)

O Developed by an experienced examiner team

O VLE-compatible ActiveTeach resource combines

including Keith Pledger and Graham Cumming.

innovative teaching resources, interactive problemsolving activities, and BBC Active video clips.

O Student and teacher resources in both print and

digital formats come packed with activities, support and targeted practice, with a real focus on assessment throughout. O Includes questions which meet the new Assessment

O Exam performance data from Edexcel’s ResultsPlus

service are used throughout the course to give unmatchable examiner insight. O Additional targeted Practice Books cater for students

Objectives and assess functional elements within GCSE Mathematics, so you can be confident that your students are fully prepared for the new-style questions.

at each end of the ability spectrum and provide crucial support for borderline C/D students.

O Questions are colour-coded according to grade target

throughout to motivate students.

authors

www.

Series Director Keith Pledger

For more on the new specifications, plus information on the extensive support available from Edexcel visit: www.maths10.co.uk.

Series Editor Graham Cumming Authors Julie Bolter Gareth Cole Gill Dyer Michael Flowers Karen Hughes Peter Jolly Joan Knott

14

Jean Linsky Graham Newman Rob Pepper Joe Petran Rob Summerson Kevin Tanner Brian Western

Evaluate Online! Visit www.pearsonschools.co.uk/tryedexcelgcsemathematics for extensive free samples, video and interactive demos

Maths 14–16

Specification A (Linear) Foundation

Higher

Specification B (Modular) Foundation

Higher

Student Books (See pages 16-17)

ActiveTeach CD-ROMs (See page 18)

Teacher Guides

Edexcel GCSE

Edexcel GCSE

Mathematics A Foundation

Mathematics A Higher

Teacher Guide

Teacher Guide

Series Director: Keith Pledger


Series Editor: Graham Cumming

(See page 19)


Edexcel GCSE

Edexcel GCSE

Mathematics A Foundation

Mathematics A Higher

Student Book

Student Book

Series Director: Keith Pledger Series Editor: Graham Cumming


CD-ROM inside

CD-ROM inside

Practice Books & Digital Editions (See pages 20-21)

Includes books for targeting A and A*, Booster C and Access.

Assessment Packs

Edexcel GCSE

Edexcel GCSE

Mathematics A

Mathematics B

Assessment Pack

Assessment Pack




(See page 22) CD-ROM inside

CD-ROM inside

ResultsPlus Booster C (See page 24)

ResultsPlus new! Booster Targeting A and A* (See page 24)

Revision (See page 23)

new!

, & %

+/","(' ."

, & %

+/","(' ." !

, & ? & , & ? &

+/","(' 0(+$?(($

+/","(' 0(+$?(($ !

(GH[FHO·VRZQFRXUVH

(GH[FHO·VRZQFRXUVH

(GH[FHO·VRZQFRXUVH

(GH[FHO·VRZQFRXUVH

new!

16+ (See page 23)

15 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Student Books Your formula for success Tailored to both the specification and the tier, the Student Books deliver exactly what students and teachers need to cover the unit in exactly the right depth. O Supports understanding of AO2 and AO3 through clearly labelled AO2/3 questions in

the exercises. O Packed with graded questions which reflect the level of demand required, so students

and teachers can see their progression. O Includes worked examples throughout the book to break the maths down into easy

chunks. O Uses Edexcel’s unique ResultsPlus exam performance data to highlight common errors.

Eye-catching chapter openers put the maths in context.

Get Ready questions quickly check prior knowledge.

Student Book: Foundation

Sample pages from Edexcel GCSE Mathematics 2010 Foundation Student Book Spec B

16

Accessible language and contemporary design throughout make it easy to engage students.

Maths 14–16 Functional Skills pages focus on the functional elements of the new GCSE specifications.

Student Book: Higher CLIMBING SNOWDON

Chapter xx xxxx

Wales. To get to the summit of nowdon is the highest mountain in Read the information below Snowdon you can walk or go by train. then answer the questions opposite.

S possible re are 5

routes up

n.

Snowdo

Distance (km)

Ascent (m)

Average time taken (hrs)

7.5

3

Llwybyr Llanberis Path

960

6.5

900

2.5

Snowdon Ranger

6.5

800

2.5

6.5

870

3

6.5

900

3.5

He

Route

Miner’s Track

South Ridge

Lliwedd

Here are the train

Level of difficulty

48(67,21

6

Striking design brings activities to life.

two children, Poppy 1. Jon, Sarah and their buy single fare and Mark are going to to the summit of tickets from Llanberis by the 9 am train Snowdon. They can go . The 9 am train is or the 11.30 am train er for the cheaper. How much cheap whole family?

2. Rashid and Chelsea eac h walk Snowdon. Ras hid takes the to the summit of and starts at Sou 0945. Chelsea th Ridge route Llwybyr Llan takes the beris Path rou te and starts They both arr at ive at the sum Rashid says mit at 1230 0930. tha . Is he right? Giv t he is the faster walker . e a reason for your answer .

feet convert graph to vis. nversion is Ben Ne the aw a co otland 3. a Dr metres. Sc in hich is n into 44 m. W mountai 13 st is he hig n Nevis b The ht of Be The heig ntain ? ou higher m

/,1.6 fares.

travel fares Llanberis – Clogwyn Return fare

Llanberis – Clogwyn Single fare

Llanberis – Summit Return fare

Llanberis – Summit Single fare

£16

£12

£23

£16

Adult

£13

£ 9

£20

£13

Senior / Student

£12

£16

£13

Child

£ 8

£ 8

£ 8

£11.50

£11.50

Early bird Adult*

£ 6

£ 6

£ 8

£ 8

Early bird Child*

*The Early Bird train departs at 9 am.

You can use a calculator to work out the costs in Question 1. You learnt this skill in Chapter 31. You need to work out time intervals for Question 2. You learnt this in Chapter 14. Question 3 asks you to draw a conversion graph. You learnt this in Chapter 20.

112

113

Sample pages from Edexcel GCSE Mathematics 2010 Higher Student Book Spec A

Chapter review sections provide a convenient summary of the key ideas.

Student Book: Foundation

Review exercises provide practice across the whole chapter.

www. For more Student Book samples visit: www.pearsonschools.co.uk/ tryedexcelgcsemathematics.

Sample pages from Edexcel GCSE Mathematics 2010 Foundation Student Book Spec B

Questions labelled with the new AO2 and A03 Assessment Objectives.

17 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

ActiveTeach The ultimate front-of-class teaching tool These VLE-compatible ActiveTeach CD-ROMs, combine BBC Active video, innovative teaching resources and interactive problem-solving activities. Immediate and easy access to highquality interactive content integrated seamlessly with the Student Book.

Multilingual glossary gives audio translations for common maths terms in five languages.

ActiveTeach

Facilitates classroom management by allowing the whole class to view items in the textbook together.

%RRN7LWOH

5HVXOWV3OXV

([DP]RQH 1.1 Understanding properties of whole numbers

1 NUMBER

Includes a VLE site pack to give you maximum flexibility of use. Tested on Fronter, Moodle and Kaleidos. Go to www.pearsonschools.co.uk/ VLEsupport to find out about compatibility with other VLEs.

1.1 Understanding properties of whole numbers Objectives

Why do this?

You can find factors of whole numbers. You can find multiples of whole numbers. You can identify prime numbers.

If you are tiling a kitchen, knowing the factors of an area will help you decide which size of tile to use to minimise the number that need to be bought.

Get Ready 1. Which one of these numbers is in the four-times table and the five-times table? 4 10 12 20 25 2. Which one of these numbers will divide exactly into 12 and into 16? 3 4 6 8 12 16 3. Which one of these numbers cannot be divided exactly by any other number except 1? 10 16 23 27 36 42

Key Points A factor of a number is a whole number that divides exactly into the number. The factors of every number always include 1 and the number itself. The factors of 8 are 1, 2, 4 and 8. A multiple of a number is the result of multiplying the number by a positive whole number. The first five multiples of 8 are 8, 16, 24, 32 and 40. A prime number is a number greater than 1 which has only two factors: itself and 1. For example, 7 is a prime number because its only factors are 1 and 7.

Example 1

1, 20 2, 10 4, 5

We all use numbers as part of our everyday life. Some of the objects that you might use every day such as mobile phones and cash cards need to be protected by powerful codes. Most of the codes used involve very large prime numbers.

Example 2

Find all the factors of 20.

Write down all the multiples of 6 between 10 and 40.

12, 18, 24, 30, 36 Objectives

Before you start

In this chapter you will: identify factors, multiples and prime numbers find the lowest common multiple and highest common factor of two numbers work with negative numbers know the correct order to carry out the different arithmetic operations apply the laws of indices.

You need to: know your multiplication tables understand index notation.

Example 3

Write down the factors in pairs. Each pair of numbers multiplies to give 20. This ensures that no factors are forgotten.

All these numbers divide into 20 exactly.

12 is the first number in the 6 times table that is greater than 10.

Which of these numbers are prime numbers?

a 9 is not a prime number b 13 is a prime number c 5 is a prime number d 22 is not a prime number

a 9

c 5

d 22

Prepares your students for exams through integrated exam support tools.

The only numbers that divide into 5 exactly are 1 and 5. 2 and 11 divide into 22 exactly so 22 is not a prime number.

factor

2

b 13

3 divides into 9 exactly so 9 is not a prime number. The only numbers that divide into 13 exactly are 1 and 13.

multiple

prime number

3

RI

Interactive Problem - Solving Sample screenshots from Edexcel GCSE Mathematics 2010 Foundation ActiveTeach

Allows you to personalise content by annotating the pages and saving your annotations, enabling you to reapply your thinking the next time you deliver the lesson.

%RRN7LWOH

5HVXOWV3OXV

([DP]RQH 1.1 Understanding properties of whole numbers

1 NUMBER

1.1 Understanding properties of whole numbers Objectives

Why do this?

You can find factors of whole numbers. You can find multiples of whole numbers. You can identify prime numbers.

If you are tiling a kitchen, knowing the factors of an area will help you decide which size of tile to use to minimise the number that need to be bought.

Get Ready 1. Which one of these numbers is in the four-times table and the five-times table? 4 10 12 20 25 2. Which one of these numbers will divide exactly into 12 and into 16? 3 4 6 8 12 16 3. Which one of these numbers cannot be divided exactly by any other number except 1? 10 16 23 27 36 42

Key Points A factor of a number is a whole number that divides exactly into the number. The factors of every number always include 1 and the number itself. The factors of 8 are 1, 2, 4 and 8. A multiple of a number is the result of multiplying the number by a positive whole number. The first five multiples of 8 are 8, 16, 24, 32 and 40. A prime number is a number greater than 1 which has only two factors: itself and 1. For example, 7 is a prime number because its only factors are 1 and 7.

Example 1

1, 20 2, 10 4, 5

We all use numbers as part of our everyday life. Some of the objects that you might use every day such as mobile phones and cash cards need to be protected by powerful codes. Most of the codes used involve very large prime numbers.

Example 2

Find all the factors of 20.

Write down all the multiples of 6 between 10 and 40.

12, 18, 24, 30, 36

www. View the ActiveTeach videos and see how ActiveTeach might work for you! www.pearsonschools.co.uk/ tryedexcelgcsemathematics

18

Objectives

Before you start

In this chapter you will: identify factors, multiples and prime numbers find the lowest common multiple and highest common factor of two numbers work with negative numbers know the correct order to carry out the different arithmetic operations apply the laws of indices.

You need to: know your multiplication tables understand index notation.

Example 3

Write down the factors in pairs. Each pair of numbers multiplies to give 20. This ensures that no factors are forgotten.

All these numbers divide into 20 exactly.

12 is the first number in the 6 times table that is greater than 10.

Which of these numbers are prime numbers?

a 9 is not a prime number b 13 is a prime number c 5 is a prime number d 22 is not a prime number

a 9

c 5

d 22

The only numbers that divide into 5 exactly are 1 and 5. 2 and 11 divide into 22 exactly so 22 is not a prime number.

factor

2

b 13

3 divides into 9 exactly so 9 is not a prime number. The only numbers that divide into 13 exactly are 1 and 13.

multiple

RI

prime number

3

Maths 14–16

Teacher Guides

Edexcel GCSE

Mathematics A Foundation Teacher Guide Series Director: Keith Pledger Series Editor: Graham Cumming

Saving you time and guiding you through the new specifications

Edexcel GCSE

Mathematics A Foundation Student Book


Higher and Foundation Teacher Guides, for both Specifications A and B, contain original and imaginative task ideas, worksheets, lesson plans and more – all of which are completely customisable via the CD-ROM.

CD-ROM inside

Clear references to the new specifications.

Editable lesson plans to save you valuable preparation time.

Teacher Guides

Sample pages from Edexcel GCSE Mathematics 2010 Higher Teacher Guide Spec A

Guided practice worksheets address any areas of weakness.

19 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Practice Books Targeted to maximise grades and help students achieve at the level that’s right for them. Providing material for consolidation, homework and independent study, the Practice Books are tailored to both the specification and the tier to deliver focused, highly targeted support for students of every ability. O Foundation and Higher Practice Books give extra consolidation work for both tiers. O Access Practice Books provide accessible practice for students working at securing a basic

pass at GCSE. Practice Books are available as VLE-compatible digital editions, which can be accessed through your network in ActiveTeach.

O Targeting A and A* Practice Books include extra, focused practice work for students

aiming for the top grades. O Booster C Practice Books support borderline D/C students aiming for that all-important

grade C.

Practice Books

Focused practice for students, whatever level they are working to.

Follow the structure of the Student Book to make setting homework more straightforward.

Sample pages from Edexcel GCSE Mathematics 2010 Access Practice Book

www. For FREE Practice Book samples visit: www.pearsonschools.co.uk/ tryedexcelgcsemathematics.

20

Maths 14–16

Booster C Practice Books Supporting your D/C Students Provides extra practice tailored to your borderline D/C students who are aiming to maximise their potential. O Activities and summaries help borderline students concentrate on the key topics they

need to master to get their grade. O Packed with practice questions, all of which are graded so students can see exactly what

level they’re working at. O Uses Edexcel’s unique ResultsPlus information to highlight the most common errors

derived from exam performance data.

Support your borderline students! Use this Practice Book with our online interactive ResultsPlus Booster to maximise your students’ potential. See Page 24 for more details!

Targeting A and A* Practice Books Aiming for the top grades Provides extra practice tailored to your students aiming for the top grades. O Challenge yourself tasks stretch your most able students and encourage them towards

A Level. O Key points boxes at the start of every chapter, provide a handy summary of the theory

students will need.

Boost your high achievers! Use this with ResultsPlus Booster Targeting A to A* to boost those top grade students. See Page 24 for more details!

Access Practice Books Help students achieve at the level that’s right for them. Provides extra practice tailored to your students working at securing a basic pass at GCSE. O Multi-part questions start below G-grade level to establish basic maths and build

confidence. O Spacious layout and colourful diagrams ensure students are engaged. O Self Assessment panels allow students to record and monitor their own progress. O Write-in format allows students to engage directly with the material.

21 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Edexcel GCSE

Assessment Pack

Mathematics A Assessment Pack Series Director: Keith Pledger Series Editor: Graham Cumming

Assessment solutions for all sets Covering both Foundation and Higher tiers, the Assessment Packs for both Edexcel specifications A and B are packed with tools to make teaching the new specifications as easy as possible. The Assessment Packs contain:

CD-ROM inside

O a guide to the 2010 specification and new-style assessment O end-of-chapter tests and new-style question bank O exam-style practice papers

Edexcel GCSE

Mathematics B

O Works with ResultsPlus Mock Analysis Service.

Assessment Pack Series Director: Keith Pledger Series Editor: Graham Cumming

Chapter tests.

CD-ROM inside

Provides extra practice for the new Assessment Objectives A02 and A03.

Assessment Pack

Each Assessment Pack contains test for both Foundation and Higher tiers.

The CD-ROM includes all tests in an editable format.

Sample pages from Edexcel GCSE Mathematics Assessment Pack Spec A Foundation and Higher

www. Download FREE samples of the Assessment Pack at: www.pearsonschools.co.uk/ tryedexcelgcsemathematics.

22

Maths 14–16

, & %

+/","(' ."

Revision Guides and new! Workbooks Edexcel’s own revision resources for GCSE Mathematics O Exclusively uses ResultsPlus data to help your students improve their understanding of

the mechanics of an exam question, by highlighting the marks available for each question, its difficulty and the popular misconceptions. (GH[FHO·VRZQFRXUVH

O No wordy complex revision concepts, lengthy preliminaries or set-up time make the

guides and workbooks instant and easy to use and administer for both teachers and students alike. O A student-friendly, page-based design presents the topics on a single page with plenty

of worked examples, making even the hardest topics seem manageable and simple to understand. O Full of exam practice meaning your students are prepared for the look and feel of the

real exam.

GCSE Maths 16+ new! Resources for post 16 learners Designed to meet the specific needs of post-16 learners taking the GCSE 2010 Mathematics specifications, this Student Book provides: O a practical one-year course designed to focus on the key topics learners will need to pass

at grade C or above. O a flexible structure so that the Student Book can be used with the Linear or Modular

specification or both. Chapters follow a topic-based order and are mapped to the Modular specification.

23 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


www. Watch a short introductory video and find out how easy it is to use and how it can help to boost your students’ performance: www.pearsonschools.co.uk/rpb.

Maths 14–16

ResultsPlus Booster for Edexcel GCSE Mathematics is an innovative online learning and assessment tool built on technology that is used by millions worldwide. Written to save you valuable time, it also allows you total transparency when it comes to tracking your students’ progress as they make their way through the tasks. ResultsPlus Booster offers: O thousands of graded guided practice questions with multimedia learning aids, giving

students a supportive environment in which to progress. O examiner written, Edexcel exam-style questions, with instant feedback, allowing

students to familiarise themselves with the new GCSE question types and requirements. O advanced reporting so you can see exactly where your students are going wrong. O personalised study plan so each student can see what topics they have mastered and

where they need to do more work.

ResultsPlus Booster C Support your borderline D/C Students! ResultsPlus Booster C takes borderline D/C through highly targeted guided practice to boost their performance and help them maximise their potential.

“The C/D borderline students have such an impact on the school results and gaining a C grade is so important for the individual student. Specially produced resources for this cohort, aiming to gain the C, are essential and ResultsPlus Booster is the best product I have seen.” Lynn Turner, Head of KS4 Maths, Thomas Tallis School

www. For more information on ResultsPlus Booster Targeting A and A* visit www.pearsonschools.co.uk/rpb.

ResultsPlus Booster – Targeting new! A and A* Support your high achievers! ResultsPlus Booster Targeting A and A* takes higher tier students through highly targeted practice to boost their performance and aim for the highest grades, as well as giving them the support they need to progress to A Level.

24

Maths 14–16 Advanced reporting tools give unmatched insight into student performance, enabling teachers to pinpoint exactly where individuals are going wrong.

Allows students to experience real Edexcel exam-style questions on screen, with the added benefit of instant examiner feedback.

Includes thousands of multi-part questions, giving students a variety of practice to meet their needs exactly.

Links seamlessly to other course components, giving students and teachers a clear, consistent learning experience.

Sample screenshot taken from ResultsPlus Booster C

Works alongside ResultsPlus Progress to allow you to address the weak areas that ResultsPlus Progress diagnoses.

Login Packs Contain 10 Student Registration Codes and three FREE Teacher Registration Codes. Available for both ResultsPlus Booster C and ResultsPlus Booster Targeting A and A*!

Bundle Packs Get great value for money with this Login Pack and Practice Book bundle, containing your 10 Student and three FREE Teacher Registration Codes and 10 Booster C Practice Books for Edexcel GCSE Mathematics. Available for ResultsPlus Booster C and ResultsPlus Booster Targeting A and A*!

www. Visit www.pearsonschools.co.uk/rpb to: O register for FREE 30 - minute online sessions that will take you through ResultsPlus Booster and everything it has to offer.

O sign up for our FREE e-Alerts on how to get the most out of ResultsPlus Booster, the latest product updates and exclusive special offers

O watch a video on how you can boost your student’ grades with ResultsPlus Booster.

25 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

ResultsPlus is an additional service provided FREE to all Edexcel centres. It works with ResultsPlus Progress to help you understand more about your students’ GCSE and GCE exam results. Using ePen, Edexcel’s unique onscreen marking technology, ResultsPlus is able to offer Edexcel centres a new level of detail in understanding and analysing their students’ Edexcel GCSE results. For more information on this FREE service available to every Edexcel centre, visit: www.resultsplus.com.

ResultsPlus Progress is Edexcel’s online diagnostic assessment service that helps you to understand your students’ performance. Each GCSE Maths product includes ten topic-based tests, with 25 questions that are perfect for both linear and modular courses. Every topic test can be taken individually or linked with others to create more comprehensive unit, termly or mock-style assessments. Students can compare their response with a model answer to help them learn from their mistakes.

ResultsPlus Progress GCSE

Test questions are written to help you and your students pinpoint their strengths and areas for improvement.

Review tests allow students to look back over their own answers and see where they went wrong.

Tests are easy to navigate, with the option to add flags to questions where a pupil is unsure. Sample screen from Results Plus Progress Foundation

Pupil analysis shows you how each student performed in a test on each question.

order Key Stage 3 (prices are per student) Year 7 Entry Test 978 1 846902 81 9

£2.50 (+VAT)

Year 7 Objectives Assessment 978 1 846902 80 2 £2.50 (+VAT) Year 7 Objectives Test (Levels 4-6) 978 1 846903 38 0 £2.50 (+VAT)

www. ResultsPlus Progress is also available at KS3! www.resultsplusprogress.com

26

Progress Assessment 4 (Levels 5CBA) 978 1 846902 76 5 £2.00 (+VAT) Progress Assessment 5 (Levels 5A/6CB) 978 1 846902 77 2 £2.00 (+VAT) Progress Assessment 6 (Levels 6A/7+) 978 1 846902 78 9 £2.00 (+VAT)

GCSE Maths 2010 New Specification (prices per student)

Year 8 Objectives Test (Levels 5-7) 978 1 846903 39 7 £2.50 (+VAT)

Foundation 978 1 846902 71 0

£3.00 (+VAT)

Progress Assessment 1 (Levels 2A/3CBA) 978 1 846902 73 4 £2.00 (+VAT)

Higher 978 1 846902 72 7

£3.00 (+VAT)

Progress Assessment 2 (Levels 3BA/4C) 978 1 846902 74 1 £2.00 (+VAT)

Foundation 978 1 846909 46 7

£2.50 (+VAT)

Progress Assessment 3 (Levels 4BA/5C) 978 1 846902 75 8 £2.00 (+VAT)

Higher 978 1 846909 47 4

£2.50 (+VAT)

Maths 14–16

order and evaluate Evaluate

Practice Books Specification B (Modular)

Evaluation Packs contain a Student Book and accompanying support material from the other course components.

Edexcel GCSE Maths Foundation Practice Book 978 1 846900 97 6 £5.99 Edexcel GCSE Maths Higher Practice Book 978 1 846900 92 1 £5.99

Edexcel GCSE Maths Specification A Evaluation Pack Contains Spec A Foundation Student Book 978 1 846906 26 8 £19.99

Edexcel GCSE Maths Access Practice Book 978 1 846906 77 0 £4.99

Edexcel GCSE Maths Specification B Evaluation Pack Contains Spec B Foundation U1 Student Book 978 1 846906 27 5 £8.99

Edexcel GCSE Maths Targeting A and A* Practice Book 978 1 846906 76 3 £6.99 Edexcel GCSE Booster C Maths Practice Book 978 1 846900 81 5 £5.99

Order - Specification A Student Books Specification A (Linear)

Practice Books Digital Editions Specification B (Modular)

Edexcel GCSE Maths Foundation Student Book 978 1 846900 88 4 £19.99

Edexcel GCSE Maths Foundation Practice Book Digital Edition 978 1 846907 95 1 £149.99 (+VAT)

Edexcel GCSE Maths Higher Student Book 978 1 846900 83 9 £19.99

Edexcel GCSE Maths Higher Practice Book Digital Edition 978 1 846907 96 8 £149.99 (+VAT)

ActiveTeach Specification A (Linear)

Edexcel GCSE Maths Access Practice Book Digital Edition 978 1 846907 97 5 £149.99 (+VAT)

Edexcel GCSE Maths Foundation ActiveTeach CD-ROM 978 1 846909 12 2 £399.99 (+VAT)

Edexcel GCSE Maths Targeting A and A* Practice Book Digital Edition 978 1 846907 94 4 £149.99 (+VAT)

Edexcel GCSE Maths Higher ActiveTeach CD-ROM 978 1 846909 13 9 £399.99 (+VAT)

Edexcel GCSE Maths Booster C Practice Book Digital Edition 978 1 846907 93 7 £149.99 (+VAT)

Teacher Guide Specification A (Linear)

Assessment Pack Specification B (Modular)

Edexcel GCSE Maths Foundation Teacher Guide 978 1 846900 87 7 £124.99

Edexcel GCSE Maths Assessment Pack with CD-ROM 978 1 846900 99 0 £149.99

Edexcel GCSE Maths Higher Teacher Guide 978 1 846900 82 2 £124.99

Order GCSE 16+

Practice Books Specification A (Linear)

Edexcel GCSE 16+ Student Book 978 1 446900 03 1 £18.99*

Edexcel GCSE Maths Foundation Practice Book 978 1 846900 89 1 £5.99

Order - ResultsPlus Booster ResultsPlus Booster C

Edexcel GCSE Maths Higher Practice Book 978 1 846900 84 6 £5.99

ResultsPlus Booster Login Pack contains 10 Student and three FREE Teacher Registration Codes 978 1 846908 47 7 £89.99 (+VAT)

Edexcel GCSE Maths Practice Book Targeting A and A* 978 1 846906 74 9 £6.99 Edexcel GCSE Booster C Maths Practice Book 978 1 846900 73 0 £5.99

Specification A Booster C Bundle contains your 10 Student and three FREE Teacher Registration Codes and 10 Booster C Practice Books. SAVE £40! 978 1 846908 52 1 £129.99 (+VAT)

Edexcel GCSE Maths Access Practice Book 978 1 846906 75 6 £4.99

Practice Books Digital Editions Specification A (Linear) Edexcel GCSE Maths Foundation Practice Book Digital Edition 978 1 846907 40 1 £149.99 (+VAT)

Specification B Booster C Bundle contains your 10 Student and three FREE Teacher Registration Codes and 10 Booster C Practice Books.

Edexcel GCSE Maths Higher Practice Book Digital Edition 978 1 846907 41 8 £149.99 (+VAT)

ResultsPlus Booster Targeting A and A*

Edexcel GCSE Maths Access Practice Book Digital Edition 978 1 846907 42 5 £149.99 (+VAT) Edexcel GCSE Maths Practice Book Targeting A and A*Digital Edition 978 1 846907 39 5 £149.99 (+VAT)

978 1 846908 92 7

£129.99 (+VAT)

SAVE £40!

ResultsPlus Booster Targeting A and A* – Login Pack containing 10 Student and 3 FREE Teacher Registration Codes. 978 1 846909 49 8 £89.99* (+VAT)

Edexcel GCSE Booster C Maths Practice Book Digital Edition 978 1 846907 38 8 £149.99 (+VAT)

ResultsPlus Booster Targeting A and A* – Single User Login login for one individual student. 978 1 846909 50 4 £9.99* (+VAT)

Assessment Pack Specification A (Linear)

All ResultsPlus Booster logins are valid for 3 years from activation.

Edexcel GCSE Maths Assessment Pack with CD-ROM 978 1 846900 71 6 £149.99

Edexcel GCSE Mathematics - Revision Specification A - Revision Guides

Order - Specification B Student Books Specification B (Modular)

Higher Revision Guide 978 1 4496900 18 5 £3.99*

Edexcel GCSE Maths U1 Foundation Student Book 978 1 846900 96 9 £8.99

Foundation Revision Guide 978 1 4496900 17 8 £3.99*

Edexcel GCSE Maths U2 Foundation Student Book 978 1 846908 05 7 £8.99

Specification A - Revision Workbooks

Edexcel GCSE Maths U3 Foundation Student Book 978 1 846908 06 4 £8.99 Edexcel GCSE Maths U1 Higher Student Book 978 1 846900 91 4 £8.99 Edexcel GCSE Maths U2 Higher Student Book 978 1 846908 07 1 £8.99 Edexcel GCSE Maths U3 Higher Student Book 978 1 846908 08 8 £8.99

ActiveTeach Specification B (Modular) Edexcel GCSE Maths Foundation ActiveTeach CD-ROM 978 1 846909 4 6 £399.99 (+VAT) Edexcel GCSE Maths Higher ActiveTeach CD-ROM 978 1 846909 15 3 £399.99 (+VAT)

Teacher Guides Books Specification B (Modular) Edexcel GCSE Maths Foundation Teacher Guide 978 1 846900 95 2 £124.99

Higher Revision Workbook 978 1 4496900 15 4 £3.99* Foundation Revision Workbook 978 1 4496900 14 7 £3.99*

Specification B - Revision Guides Higher Revision Guide 978 1 4496900 16 1 £3.99* Foundation Revision Guide 978 1 4496900 19 2 £3.99*

Specification B - Revision Workbooks Higher Revision Workbook 978 1 4496900 13 0 £3.99* Foundation Revision Workbook 978 1 4496900 12 3 £3.99*

* Prices are provisional until publication.

Edexcel GCSE Maths Higher Teacher Guide 978 1 846900 90 7 £124.99

27 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Edexcel

Functional Mathematics

Edexcel Functional Skills Mathematics Edexcel’s own resources for Functional Skills Mathematics

Written by "VUIPS0OF "VUIPS5XP "VUIPS5ISFF

Written by the authors and teachers of the pilot scheme, our resources are tailored to the new Edexcel Functional Skills Mathematics specification so you know you are covering everything you need to. O Comprehensive coverage of the specification with a real focus on both process skills and

Topic-based chapters build confidence with Functional questions and link to the GCSE.

practice. O Suitable for use at either Key Stages 3 or 4, so teachers can teach the way they want to.

Student Book Colour Bars show ramped complexity of questions.

Worked examples plus examiner hints and tips.

Know Zone pages are easy to read and provide key maths content.

Sample pages from Edexcel Functional Skills Mathematics 2010 Student Book 2

Chapters carefully progress from less to more complex tasks to build confidence.

Regular assessment practice sections throughout.

Exam - style questions.

28

Maths 14–16

ActiveTeach Our ActiveTeach CD-ROMs for both Levels 1 and 2 provide a wide range of resources and are enriched with video clips for great whole-class teaching.

Allows you to personalise content by interacting directly with the text and saving your own annotations, enabling you to reapply your thinking the next time you deliver the lesson.

ActiveTeach VLE-compatible ActiveTeach CD-ROMS combine video, innovative teaching resources and interactive problems solving activities.

Facilitates classroom management by allowing the entire class to view items in the textbook together.

Immediate and easy access to high-quality interactive content integrated seamlessly with the Student Book.

Includes a VLE site pack to give you maximum flexibility of use. Tested on Fronter, Moodle and Kaleidos. Go to www.pearsonschools.co.uk/ VLEsupport to find out about compatibility with other VLE products.

Sample screenshot from Edexcel Functional Skills Mathematics ActiveTeach

Teacher Guides Teacher Guides for both Level 1 and Level 2 contain resources including lesson plan, worksheets and practice assessment papers, alongside information on mapping the course to GCSE. O The Teacher Guide provides a complete set of lesson plans for a Functional Skills Maths

course. O Starters, main activity and plenary. O Notes on common misconceptions and other issues. O Support and extension ideas plus formative assessment activities.

order and evaluate Evaluate The Evaluation Pack contains a copy of the Student Book and sample material from the other course components.

www. For more information and to view FREE samples of Functional Skills resources visit: www.pearsonschools. co.uk/edexcelfsmaths.

Edexcel Functional Skills Maths Evaluation Pack 978 0 997845 57 0 £8.99

Order Edexcel Functional Skills Maths Student Book Level 1 978 1 846907 69 2 £8.99

Edexcel Functional Skills Maths ActiveTeach Level 1 978 1 846907 67 8 £199.99 (+VAT) Edexcel Functional Skills Maths ActiveTeach Level 2 978 1 846907 68 5 £199.99 (+VAT) Edexcel Functional Skills Maths Teacher Guide Level 1 978 1 846907 71 5 £99.99 Edexcel Functional Skills Maths Teacher Guide Level 2 978 1 846907 72 2 £99.99

Edexcel Functional Skills Maths Student Book Level 2 978 1 846907 70 8 £8.99

29 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–1614–16 Maths

AQA GCSE Mathematics All set to make the grade

M de AK

e MA ad

he Gra ET

The Gr KE

e MAK ad

e MA ad

e MAK ad

he Gr ET

GCSE

GCSE

GCSE

mathematics

atics mathdaetiom n sets

for Middle sets

for FounPayne

Series editor: Glyn Payn

e

n Series editor: Gly

M de AK

he Gra ET

The Gr KE

he Gr ET

ics t a m e h t a m her sets for HigGlyn Payne Series edito

r:

'HVLJQBB0DWKVBFRYHUB7(

67LQGG

L GG

O Resources for the AQA GCSE 2010 Linear and Modular

specifications. O The best value for money: textbooks covering the whole

teaching resources, including BBC Active video clips and interactive problem-solving activities. O Our resources deliver complete clarity on the new

course, not year books or unit books. O Written by a team of senior examiners and practising

teachers. O Unique three-book model, with clear on-page grading,

helps students to achieve their best grade. O Complete course textbook for your middle sets, leading to

more grade Cs.

O VLE-compatible ActiveTeach CD-ROM provides engaging

Assessment Objectives – AO2 and AO3 – as well as assessing the Functional Mathematics components, meaning you can deliver AQA’s new GCSE specifications with confidence. O Additional targeted practice designed for students at each

end of the ability spectrum and providing crucial support for middle sets students.

authors Series Editor Glyn Payne Authors Gwen Burns Greg Byrd Lynn Byrd Crawford Craig Janet Crawshaw Fiona Mapp

30

Avnee Morjaria Catherine Murphy Katherine Pate Ian Robinson Harry Smith

Evaluate Online! www.pearsonschools.co.uk/tryaqagcsemaths

Maths 14–16

course structure

The Gr KE

e MA ad

e MA ad

The Gr KE

The Gr KE

The Gr KE

GCSE

GCSE

GCSE

mathematics

mathematics

mathematics

Series editor: Glyn Payne


for Higher sets

for Middle sets

e MA ad

e MA ad

Foundation Sets G–C

e MA ad

See pages 32-33

The Gr KE

e MA ad

Student Books

Middle Sets E–B

The Gr KE

Higher Sets D–A*

for Foundation sets


Active Teach See page 34

de MA

de MA

The Gra KE

The Gra KE

Teacher Guides

GCSE

mathematics for Middle sets

TEACHER GUIDE

See page 37

with editable CD-ROM Series editor: Glyn Payne

Practice Books & Digital Editions

de MA

de MA

The Gra KE

The Gra KE

GCSE


TEACHER GUIDE with editable CD-ROM Series editor: Glyn Payne

See page 35

Includes books for A–A*, Practice and G–F.

Assessment Pack See page 36

31 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16 e MA ad

e MA ad

The Gr KE

The Gr KE

GCSE

Student Books Vibrant and eye-catching, our contemporary-feel Student Books will appeal to students of all abilities, making progression and engagement as easy as possible. O The Higher Sets Student Book covers grades D to A*. O The Middle Sets Student Book covers grades E to B.

mathematics for Higher sets

O The Foundation Sets Student Book covers grades G to C.


Foundation Student Book

Functional Maths questions within exercises.

Middle Student Book

Sample page from AQA GCSE Mathematics Foundation Sets Student Book

Skills check boxes remind students of the basic maths needed.

Higher Student Book

Worked examples show clearly how to structure an answer.

Sample page from AQA GCSE Mathematics Middle Sets Student Book

Ideal for use with both modular and linear specifications.

Sample page from AQA GCSE Mathematics Higher Sets Student Book

32

Maths 14–16 e MA ad

e MA ad

The Gr KE

The Gr KE

GCSE

Student Book

Worked examples break the maths down into easy chunks.

mathematics for Foundation sets Series editor: Glyn Payne

Graded objectives start each section.

All questions are graded, showing students how they are progressing.

Sample pages from AQA GCSE Mathematics Foundation Sets Student Book

Student Book New Assessment Objectives are clearly flagged throughout.

Full support for A02, A03 and Functional Elements.

www. Have you seen our blog? http://aqagcsemaths.wordpress.com for FREE resources, information and comment!

Sample pages from AQA GCSE Mathematics Foundation Sets Student Book

33 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

ActiveTeach CD-ROMs The ultimate front-of-class teaching tool View the Student Book on a whiteboard with your class, while accessing a wide variety of exciting video clips, problem-solving interactives, quizzes and other features. O BBC Active video provides an engaging start to lessons, and comes with lesson notes and

hand-outs to stimulate discussion and interest. O Grade Studio for interactive practice for AO2 and AO3 questions. O Exam Café is on hand with a wide range of lesson plans, activities and hand-outs for front-of-class

teaching during the crucial revision period. O Watch the Examiner video clips give you and your students privileged access to how examiners

mark papers, common pitfalls to avoid, and tips for picking up quick marks. O Our new Lesson Player allows you to pre-arrange your own content alongside ours, and then play

them in sequence through the lesson. O Record the progress of your class through the different topics with our new class tracker. O Our unique multilingual glossary helps support EAL students of all abilities. O Work a question with your class and save your notes. ActiveTeach is enriched with BBC Active video clips to bring maths to life.

O Includes a VLE site pack to give you maximum flexibility of use. Tested on Fronter, Moodle and

Kaleidos. Go to www.pearsonschools.co.uk/VLEsupport to find out about compatibility with other VLEs.

Grade Studio

Grade Studio provides interactive practice for AO2 and AO3 questions.

Write on any part of the Student Book and save your changes.

Sample screenshots from AQA GCSE Mathematics ActiveTeach CD-ROM

www. View the ActiveTeach demo and see what ActiveTeach can do for you! www.pearsonschools.co.uk/ tryaqagcsemaths

34

Work a question with your class and save your notes.

Maths 14–16

Practice Books

e MA ad

e MA ad

The Gr KE

The Gr KE

Targeted practice for total support Matching the Student Books to ensure homework setting is as easy as possible, this series of five Practice Books offers focused support for every ability range.

mathematics A to A* practice

G–F Practice Book


This book is written exclusively for your weaker students. It deconstructs maths to its simplest elements to build students’ confidence in securing grades G to F.

A–A* Practice Book This book is written to excite your brightest students and help them win every mark they need for their A* grade. Each of the Practice Books contains a complete set of modular and linear exam-style practice papers at the back.

Digital Editions

AO2, AO3 and Functional Maths practice included so you can be confident this is covered.

All of the Practice Books are available as digital editions allowing you to display questions and answers for front-of-class reviews of homework.

All questions are graded so students can see what level they are working at and can push themselves to achieve more.

Foundation Sets Practice Book

$YHUDJHVDQGUDQJH

/LQNVWR Middle Sets Student Book Ch4, pp.122–134

.H\3RLQWV E

$YHUDJHVDQGUDQJH

D

*URXSHGIUHTXHQF\WDEOHDYHUDJHV

A–A* Practice Book

$UFVFRQHVDQGVSKHUHV

.H\3RLQWV $UFV

Arc length

A

&RQHV

AA

*

r

Ƨ

(VWLPDWLQJWKHPHDQIURPDJURXSHG IUHTXHQF\WDEOH

n.

l

C

h

Curved surface area of cone = 6HFWRUV

The book corresponds to the matching Student Book, making homework setting easy.

/LQNVWR Higher Student Book Ch.26, pp.521–527

A

6SKHUHV

r

AA

*

G-F Practice Book

r

&DOFXODWLQJWKHPHDQIURPDIUHTXHQF\WDEOH D

Ƨ r

$YHUDJHVDQGUDQJH This stem and leaf diagram shows the results from the men’s 400 m final at the Beijing Olympics. a Work out the range for this data. b Work out the median time. c Calculate the mean time. Round your answer to 1 decimal place.

4

E AO 2

45 1.0 litres

1124 1.6 litres

1.1 litres

2.2 litres

2.0 litres

A

Mar

Apr

May

Jun

Jul

b

[

c

FP

/LQNVWR Foundation Student Book Ch.6, pp.101–120

5DQJH

F

0HDQ

F

d

18mm

144˚

280˚

[

Sanu

French

History

Geography

70%

75%

65%

Amy

a

Oct

Nov

[

0RGH

/LQNVWR Section 6.2, p.104

2 Calculate the area of each sector. Give your answers in terms of π.

60% TI

Sept

306˚

FP

6 cm

Aug

G F

0HGLDQ

Calculate the missing lengths in these circles. Give your answers in terms of π where necess [

Dec

d

G

72˚ 40 mm

20 cm

Karl writes down the ages of the members of his table tennis club:

&&

-

.

&'

&%

.

&&

&&

&%

AO 2

A*

Which age appears most often in the list? 2

3 Andrea wants to plant radishes. 40˚

2

Each radish plant needs an area of 30 cm to grow. The diagram shows one of Andrea’s vegetable beds. It is made from a rectangle and a sector of a circle. How many radish plants can Andrea grow in this vegetable bed? 4 What percentage of this

circle is shaded? Give your answer to 3 s.f.

20 cm 50 cm

wire of length 58 mm. Find the length U.

AO 3

Declan asked a group of his friends what their favourite games console was. He recorded his results in a tally chart.

;ER[

OOOO OOO

3OD\VWDWLRQ

OOOO OOOO O

Which games console is the mode?

1LQWHQGR:LL

OOOO OO

1LQWHQGR'6

OOO

5 This earring is made from a piece of

r

www.

1

120˚ 6 cm

A

Sample pages from AQA GCSE Mathematics Foundation, Middle and Higher Sets Practice Books

c 14 mm

135˚

They choose to pay the same amount each month by direct debit. Estimate how much they should pay each month.

1XPEHUVNLOOV

b

O NA L

£85.52 £93.25 £59.39 £38.15 £18.50 £20.24 £16.61 £24.38 £38.23 £40.86 £86.37 £91.62

/LQNVWR Section 26.3, p.521

UN C

Feb

6HFWRUVDQGDUFV

150˚

This table shows the monthly electricity bills for a family in 2009. Jan

AO 3

1

In a survey of 85 people the median age was 37. How many people in the survey were older than 37? Sanu and Amy recorded their scores in three different tests. Sanu and Amy had the same mean test score. The range of Amy’s results was three times the range of Sanu’s results. Amy’s best result was in Geography. Copy and complete the table using this information.

G

0RGH

Key: 43 | 8 means 43.8 seconds

ÝF

5

E

788

UN ÝF C

3

The capacities of six different car engines are displayed. Unfortunately, one of the values has had oil spilt on it. The mean of this data is 1.7 litres. Work out the missing data value.

8

44

ON A L

2

43

TI

1

E

$YHUDJHVDQGUDQJH .H\3RLQWV

75˚

G

*HRPHWU\DQGDOJHEUD

3

These are the names of the people who work for a company. Alice

Holly

Lydia

Tom

Chris

Alice

Paul

Deepa

Andrew

Which name is the mode? One person leaves the company and a new person joins. Now the name that is the mode is &KULV. Write the missing names in these sentences.

For information on the Practice Books visit: www.pearsonschools.co.uk/ aqagcsemaths.

Suitable for consolidation in school, homework and independent study.

The name of the person who left was AO 2

The name of the person who joined was $VVHVV\RXUVHOI

1XPEHUVNLOOV

35 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Assessment Pack Covering both Higher and Foundation tiers, our Assessment Pack guides you through the new AQA GCSE Mathematics modular and linear specifications and provides complete clarity on the new Assessment Objectives (AO2 and AO3). With a focus solely on assessment, you can be confident that you’ll be supporting your students in getting their best marks. O Chapter tests for every Student Book chapter. O A complete set of result practice papers is provided for students needing further exam practice. O Class tracker – enabling you to record students’ progress through the course and helping to inform

your decision about which tier to enter them into. O A free CD-ROM allowing you to edit all the materials, which also works alongside any ActiveTeach

product from our AQA GCSE Mathematics 2010 series.

Assessment Pack

(.+,'-+2,- '#- /%, 5

Course entry tests to help set your students for GCSE.

/%, 5 %.%-(+%%(0 3 "-,-#, &#'.-,%('! 3 (.&2.,%.%-(+ (+'2*.,-#('#'-"#,-,- 3 (.0#%%' )')'#%+.++.%+''!%&,.++(+)+(-+-(+ -+#'!))+'&#++(+()-#('%'%.%-(+ 3 "#,-,-,-+-,0#-",#+*.,-#(', 3 +2-(',0+%%-"*.,-#(', 3 +#-%%2(.+',0+,'0(+$#'!#'-",))+(/#('-"-,-))+('(- 0+#-(.-,#-"(1+(.'")!(+('%'$)!,+$,&20+ (+0(+$#'! 3 "$2(.+0(+$+ .%%2 3 ,$2(.+-"+# 2(.+'(-,.+0"--((

4+,('.-#(' "#,#-%(.&'-&2"/'%-+ +(&-"(+#!#'%

Sample pages from AQA GCSE Mathematics Assessment Pack

www. For FREE Assessment Pack samples: www.pearsonschools.co.uk/ tryaqagcsemaths.

36

-"&-#, (+ 5 ,,,,&'-$

Exam-style practice papers for all three units and both tiers, including A02, A03 and Functional Skills questions.

Maths 14–16

Teacher Guides

e MA ad

e MA ad

The Gr KE

The Gr KE

GCSE

Support to deliver the new specifications Written to support you through the teaching of the AQA GCSE Mathematics 2010 specification, these three Teacher Guides are available for Higher Sets, Middle Sets and Foundation Sets.


Packed with activities for whole-class and individual work, they also include editable CD-ROMs so you can adapt the material to your own needs.

TEACHER GUIDE with editable CD-ROM Series editor: Glyn Payne

Guided practice worksheets.

Teacher Guides

Links to guided practice Worksheets.

$YHUDJHVDQGUDQJH

2EMHFWLYHV x )LQGWKHPHDQPHGLDQDQGUDQJHIURPDVHWRIGDWDLQFOXGLQJGDWD JLYHQLQDVWHPDQGOHDIGLDJUDP('

3ULRUNQRZOHGJH 6WXGHQWVVKRXOGEHDEOHWRRUGHUZKROHQXPEHUVDQGGHFLPDOV7KH\ VKRXOGDOVREHDEOHWRILQGWKHQXPEHUKDOIZD\EHWZHHQWZRQXPEHUV

6WDUWHU 'LVSOD\D±QXPEHUOLQHRQWKHERDUG:ULWHGHFLPDOVEHWZHHQDQG RQVWLFN\QRWHVDQGDVNVWXGHQWVWRSODFHWKHPLQWKHFRUUHFWSRVLWLRQV RQWKHQXPEHUOLQH

$YHUDJHVDQGUDQJH

2EMHFWLYHV

0RGXODUDQGOLQHDU VSHFLILFDWLRQUHIHUHQFH 66

x )LQGWKHPHDQPHGLDQDQGUDQJHIURPDVHWRIGDWDLQFOXGLQJGDWD JLYHQLQDVWHPDQGOHDIGLDJUDP('

.H\ZRUGV DYHUDJHPHDQPHGLDQPRGH PRGDOYDOXHUDQJH

3ULRUNQRZOHGJH 6WXGHQWVVKRXOGEHDEOHWRRUGHUZKROHQXPEHUVDQGGHFLPDOV7KH\ VKRXOGDOVREHDEOHWRILQGWKHQXPEHUKDOIZD\EHWZHHQWZRQXPEHUV

5HVRXUFHV VWLFN\QRWHV

6WDUWHU

*XLGHG3UDFWLFH:RUNVKHHW $YHUDJHVDQGUDQJH

'LVSOD\D±QXPEHUOLQHRQWKHERDUG:ULWHGHFLPDOVEHWZHHQDQG RQVWLFN\QRWHVDQGDVNVWXGHQWVWRSODFHWKHPLQWKHFRUUHFWSRVLWLRQV RQWKHQXPEHUOLQH

$FWLYH7HDFKUHVRXUFHV $QLPDWLRQVî

0RGXODUDQGOLQHDU VSHFLILFDWLRQUHIHUHQFH 66 .H\ZRUGV DYHUDJHPHDQPHGLDQPRGH PRGDOYDOXHUDQJH 5HVRXUFHV VWLFN\QRWHV *XLGHG3UDFWLFH:RUNVKHHW $YHUDJHVDQGUDQJH $FWLYH7HDFKUHVRXUFHV $QLPDWLRQVî

0DLQWHDFKLQJ

%%&$FWLYHYLGHRFOLSVî

0DLQWHDFKLQJ

%%&$FWLYHYLGHRFOLSVî

x ,QWURGXFHDYHUDJHVDQGUDQJH

7RSLF7XWRU

x ,QWURGXFHDYHUDJHVDQGUDQJH

7RSLF7XWRU

R ([SODLQWKDWWKHUHDUHWKUHHGLIIHUHQWW\SHVRIDYHUDJH([SODLQWKDW WKHPHGLDQWHOOV\RXWKHPLGGOHYDOXHDQGWKHPRGHWHOOV\RXWKH PRVWFRPPRQYDOXH([SODLQWKDWWKHPHDQLVWKHRQO\DYHUDJH ZKLFKWDNHVLQWRDFFRXQWDOOWKHYDOXHV

/LQNV KWWSZZZEEFFRXNVNLOOVZLVH QXPEHUVKDQGOLQJGDWDQXPHULFD ODQDO\VLVPHDQIODVKVKWPO

R ([SODLQWKDWWKHUDQJHLVDPHDVXUHRIKRZVSUHDGRXWWKHGDWDLV

$IODVKDFWLYLW\H[SORULQJWKH PHDQ

x *DWKHUSULPDU\GDWDIURPWKHFODVV R &KRRVHVWXGHQWVDQGDVNWKHPKRZPDQ\EURWKHUVRUVLVWHUVWKH\ KDYH5HFRUGWKHUHVXOWVLQDOLVWRQWKHERDUG$VNVWXGHQWVWR FDOFXODWHWKHPHDQPHGLDQPRGHDQGUDQJHRIWKHGDWD5HYLVH PHWKRGVRIFDOFXODWLQJDYHUDJHVDQGUDQJHLIQHFHVVDU\ Q R +LJKOLJKWWKHIDFWWKDWWKHPHGLDQLVWKH WKYDOXHDQG H[SODLQWKDWZLWKDQHYHQQXPEHURIGDWDYDOXHVWKHUHDUHWZR PLGGOHYDOXHVDQGWKDWWKHPHGLDQLVKDOIZD\EHWZHHQWKHP

R ([SODLQWKDWWKHUHDUHWKUHHGLIIHUHQWW\SHVRIDYHUDJH([SODLQWKDW WKHPHGLDQWHOOV\RXWKHPLGGOHYDOXHDQGWKHPRGHWHOOV\RXWKH PRVWFRPPRQYDOXH([SODLQWKDWWKHPHDQLVWKHRQO\DYHUDJH ZKLFKWDNHVLQWRDFFRXQWDOOWKHYDOXHV

/LQNV KWWSZZZEEFFRXNVNLOOVZLVH QXPEHUVKDQGOLQJGDWDQXPHULFD ODQDO\VLVPHDQIODVKVKWPO

R ([SODLQWKDWWKHUDQJHLVDPHDVXUHRIKRZVSUHDGRXWWKHGDWDLV

$IODVKDFWLYLW\H[SORULQJWKH PHDQ

x *DWKHUSULPDU\GDWDIURPWKHFODVV

KWWSZZZTXLDFRPUUKW PO

R &KRRVHVWXGHQWVDQGDVNWKHPKRZPDQ\EURWKHUVRUVLVWHUVWKH\ KDYH5HFRUGWKHUHVXOWVLQDOLVWRQWKHERDUG$VNVWXGHQWVWR FDOFXODWHWKHPHDQPHGLDQPRGHDQGUDQJHRIWKHGDWD5HYLVH PHWKRGVRIFDOFXODWLQJDYHUDJHVDQGUDQJHLIQHFHVVDU\ Q R +LJKOLJKWWKHIDFWWKDWWKHPHGLDQLVWKH WKYDOXHDQG H[SODLQWKDWZLWKDQHYHQQXPEHURIGDWDYDOXHVWKHUHDUHWZR PLGGOHYDOXHVDQGWKDWWKHPHGLDQLVKDOIZD\EHWZHHQWKHP

$QLQWHUDFWLYHTXL]RQPHDQ PHGLDQPRGHDQGUDQJH )ROORZXS 0LGGOH3UDFWLFH%RRN

x 'LVSOD\([DPSOHXVLQJ$FWLYH7HDFKDQGZRUNWKURXJKWKHSDUWVVWHS E\VWHS

x 'LVSOD\([DPSOHXVLQJ$FWLYH7HDFKDQGZRUNWKURXJKWKHSDUWVVWHS E\VWHS

&RPPRQPLVWDNHVDQGPLVFRQFHSWLRQV

&RPPRQPLVWDNHVDQGPLVFRQFHSWLRQV

6WXGHQWVRIWHQRPLWXQLWVZKHQZULWLQJDYHUDJHVRUUDQJH

6WXGHQWVRIWHQRPLWXQLWVZKHQZULWLQJDYHUDJHVRUUDQJH

3OHQDU\

3OHQDU\

&DOFXODWHWKHPHDQPHGLDQPRGHDQGUDQJHRIWKHZRUGOHQJWKVLQD VHQWHQFHIRUH[DPSOHWKHILUVWµ:K\OHDUQWKLV¶VHQWHQFHXVLQJ $FWLYH7HDFK

&DOFXODWHWKHPHDQPHGLDQPRGHDQGUDQJHRIWKHZRUGOHQJWKVLQD VHQWHQFHIRUH[DPSOHWKHILUVWµ:K\OHDUQWKLV¶VHQWHQFHXVLQJ $FWLYH7HDFK

KWWSZZZTXLDFRPUUKW PO $QLQWHUDFWLYHTXL]RQPHDQ PHGLDQPRGHDQGUDQJH )ROORZXS 0LGGOH3UDFWLFH%RRN

Editable schemes of work.

Full linear schemes of work also provided. 0LGGOHVHWV

$YHUDJHVDQGUDQJH

0LGGOHVHWV

$YHUDJHVDQGUDQJH

/RQJPDQ$4$*&6(0DWKV7ZR\HDU0RGXODU6FKHPHRI:RUN±6WDUWLQJZLWK8QLW±IRU0LGGOHVHWV

Sample pages from AQA GCSE Mathematics Middle Sets Teacher Guide

Editable lesson plans designed to save you valuable preparation time.

Clear references to the new specification.

)XOO6FKHPHRI:RUNIRU0LGGOHVHWVWDNLQJ+LJKHURU)RXQGDWLRQ7LHU *UH\WH[WLQGLFDWHVFRQWHQWWKDWZLOORQO\EHH[DPLQHGDW+LJKHU7LHU &KDSWHU1XPEHUVNLOOV 7LPHKRXUV>)@KRXUV>+@ 1$GGVXEWUDFWPXOWLSO\DQGGLYLGHDQ\QXPEHU 1$SSUR[LPDWHWRDJLYHQSRZHURIXSWRWKUHHGHFLPDOSODFHVDQGRQHVLJQLILFDQWILJXUH 1K$SSUR[LPDWHWRVSHFLILHGRUDSSURSULDWHGHJUHHVRIDFFXUDF\LQFOXGLQJDJLYHQQXPEHURIGHFLPDOSODFHVDQGVLJQLILFDQWILJXUHV /HDUQLQJREMHFWLYHV *UDGH 5HVRXUFH &RPPRQPLVWDNHVDQGPLVFRQFHSWLRQV 6XSSRUWDQG KRPHZRUN $4$*&6(0DWKV 0LGGOH 0LGGOH $4$0RGXODU 0LGGOHVHWV VHWV VHWV VSHFLILFDWLRQ 6WXGHQW%RRN 7HDFKHU 3UDFWLFH UHIHUHQFH 0LGGOHVHWV *XLGH %RRN 7HDFKHU*XLGH 1XPEHUVNLOOVDGGLQJDQGVXEWUDFWLQJ1 PXOWLSO\LQJDQGGLYLGLQJ1 11 0XOWLSO\ZKROH (' 6HFWLRQ )RUJHWWLQJWRDGGWKHQXPEHUVWRILQGWKHILQDO *3: 6HFWLRQ QXPEHUVXVLQJ DQVZHUZKHQXVLQJWKHJULGPHWKRG ZULWWHQPHWKRGV )RUJHWWLQJWKH]HURZKHQPXOWLSO\LQJE\WHQVZKHQ 8VHUHSHDWHG XVLQJWKHVWDQGDUGPHWKRG VXEWUDFWLRQIRU :ULWLQJWRUHSUHVHQWUHPDLQGHU GLYLVLRQRIZKROH 1RWJLYLQJDQDQVZHULQWKHFRQWH[WRIWKHSUREOHP QXPEHUV 5RXQGXSRUGRZQLQ FRQWH[W 11K &KHFNDQGHVWLPDWH ('& 6HFWLRQ )LQGLQJDQDSSUR[LPDWHYDOXHLQGHSHQGHQWRIWKH 6HFWLRQ DQVZHUVWRSUREOHPV FRQWH[WLQZKLFKLWLVVHW (VWLPDWHDQVZHUVWR :RUNLQJRXWWKHDFWXDODQVZHULQVWHDGRIDQ SUREOHPVLQYROYLQJ DSSUR[LPDWLRQ GHFLPDOV 0DNHHVWLPDWHVDQG DSSUR[LPDWLRQVRI FDOFXODWLRQV 1 0XOWLSO\DQGGLYLGH ( 6HFWLRQ $SSO\LQJWKHµJHQHUDOUXOHV¶WKHVLJQVDUHGLIIHUHQW 6HFWLRQ

3HDUVRQ(GXFDWLRQ/LPLWHG

Full guidance on teaching AO2, AO3 and necessary Functional Mathematics elements.

Sample page from AQA GCSE Mathematics Middle Sets Teacher Guide

Links to Practice Book.

37 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

www. Evaluate all resources for this course online at: www.pearsonschools.co.uk/ tryaqagcsemaths.

order and evaluate Evaluate The Evaluation Pack contains a copy of the Middle Sets Student Book and accompanying support material from the other components. AQA GCSE Mathematics 2010 Evaluation Pack 978 1 408237 75 5 £19.99

Order Student Books AQA GCSE Mathematics for Foundation Sets Student Book 978 1 408232 75 0 £19.99 AQA GCSE Mathematics for Middle Sets Student Book 978 1 408232 82 8 £19.99 AQA GCSE Mathematics for Higher Sets Student Book 978 1 408232 78 1 £19.99

AQA GCSE Mathematics G–F Practice Book 978 1 408240 90 8 £4.99

Practice Books – Digital Editions AQA GCSE Mathematics for Foundation Sets Practice Book: Digital Edition 978 1 408243 81 7 £149.99 (+VAT) AQA GCSE Mathematics for Middle Sets Practice Book: Digital Edition 978 1 408243 84 8 £149.99 (+VAT) AQA GCSE Mathematics for Higher Sets Practice Book: Digital Edition 978 1 408243 83 1 £149.99 (+VAT) AQA GCSE Mathematics A–A* Practice Book: Digital Edition 978 1 408243 80 0 £149.99 (+VAT)

ActiveTeach

AQA GCSE Mathematics G–F Practice Book: Digital Edition 978 1 408243 82 4 £149.99 (+VAT)

AQA GCSE Mathematics for Foundation Sets ActiveTeach CD-ROM 978 1 408259 26 9 £399.99 (+VAT)

Assessment Pack

AQA GCSE Mathematics for Middle Sets ActiveTeach CD-ROM 978 1 408259 28 3 £399.99 (+VAT) AQA GCSE Mathematics for Higher Sets ActiveTeach CD-ROM 978 1 408259 27 6 £399.99 (+VAT)

Practice Books AQA GCSE Mathematics for Foundation Sets Practice Book 978 1 408232 73 6 £5.99 AQA GCSE Mathematics for Middle Sets Practice Book 978 1 408232 81 1 £5.99 AQA GCSE Mathematics for Higher Sets Practice Book 978 1 408232 77 4 £5.99

38

AQA GCSE Mathematics A–A* Practice Book 978 1 408240 89 2 £6.99

AQA GCSE Mathematics Assessment Pack with CD-ROM 978 1 408232 84 2 £149.99

Teacher Guides AQA GCSE Mathematics for Foundation Sets Teacher Guide 978 1 408232 74 3 £124.99 AQA GCSE Mathematics for Middle Sets Teacher Guide 978 1 408232 83 5 £124.99 AQA GCSE Mathematics for Higher Sets Teacher Guide 978 1 408232 79 8 £124.99

Maths 14–16

AQA Functional Mathematics

e MA ad

e MA ad

The Gr KE

The Gr KE

A one-stop solution Written by senior examiners and authors of previous pilot schemes, our AQA Functional Mathematics resources work both as a stand-alone course or integrated into your GCSE or KS3 teaching. O For integrated courses

mathematics

We’ve organised our resources by mathematical topic, so you can see at a glance how to integrate your Functional teaching with your GCSE teaching.


O For stand-alone courses

Each chapter opens with ‘Practise the Maths’ – two pages of learning and practice to ensure students achieve basic competency before tackling Functional questions.

Student Book The Student Book covers both Levels 1 and 2 and comes packed with real-life scenarios, newspaper cuttings, timetables, maps and charts to bring maths into the real world.

Student Book Covers both Levels 1 and 2 with every question graded according to difficulty.

Open questions are clearly flagged in all chapters.

Sample pages from AQA Functional Skills Mathematics Student Book

Dedicated sections help students practise representation, analysis and interpretation skills needed for functional maths questions.

www. For FREE AQA Functional Maths samples: www.pearsonschools.co.uk/ tryaqagcsemaths.

Comes packed with real-life scenarios, newspaper cuttings, timetables, maps and charts to bring maths into the real world.

39 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

ActiveTeach ActiveTeach presents the Student Book on-screen and is home to a range of additional resources, including video clips, interactive problem-solving, ‘Examiner Live’ audio-files and a multilingual glossary. Includes a VLE site pack to give you maximum flexibility of use. Tested on Fronter, Moodle and Kaleidos. Go to www.pearsonschools.co.uk/VLEsupport to find out about compatibility with other VLEs.

Provide your students with crucial revision guidance and content in our popular Exam Cafe.

ActiveTeach

Use Examiner Live to access comprehensive audio clips, ideal for weaker students and auditory learners.

www. To view a demo of ActiveTeach visit: www.pearsonschools.co.uk/ tryaqagcsemaths.

Sample screenshot from AQA GCSE Functional Skills Mathematics ActiveTeach

Features our innovative Grade Studio, which provides interactive practice for problem-solving and open questions.

40

Maths 14–16 Teacher Guide Covering both Levels 1 and 2, the Teacher Guide contains almost 200 pages of resources including lesson plans, worksheets and practice assessment papers. It also contains multiple schemes of work to suit all courses both stand-alone and intergrated GCSE/Functional courses.

Includes a complete set of lesson plans and worksheets to match every chapter in the Student Book, as well as a CD-ROM containing all the files in an editable format.

Levels 1 and 2 practice exam papers have been written to match the new specifications precisely.

Teacher Guide

Sample pages from AQA GCSE Functional Skills Mathematics Teacher Guide

Extension questions and guided practice worksheets provide further support for your brighter and weaker students respectively.

Comes with multiple schemes of work to suit all courses – stand-alone functional courses and the integrated GCSE courses.

order and evaluate Functional Skills Evaluate

Order

The Evaluation Pack contains a copy of the Student Book and sample material from the other course components. AQA Functional Mathematics Evaluation Pack 978 1 408251 30 0 £9.25

AQA Functional Maths Student Book 978 1 408260 00 5 £9.25 AQA Functional Maths ActiveTeach CD-ROM 978 1 408259 99 3 £310.00 (+VAT) AQA Functional Maths Teacher Guide 978 1 408260 01 2 £128.70

41 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Edexcel IGCSE Mathematics Edexcel’s own resources for the 2009 IGCSEs in Mathematics (Specifications A and B) and Further Pure Mathematics Edexcel’s own Student Book for the 2009 Edexcel IGCSE Mathematics specification provides complete coverage so you can be sure you and your students have all the material you need.

authors D.A. Turner, I.A. Potts, W.R.J. Waite, B.V. Hony Revised for the new specification by D.A. Turner and I.A. Potts

O Available for both Specifications A and B. O Student Books contain exam practice throughout, with revision sections, practice exam

questions and extended investigations. More than 3000 questions spread throughout the book allow students to get lots of practice before sitting their exams. O Include a FREE ActiveBook CD-ROM, containing a digital version of the Student Book,

plus e-tutorials with worked solutions and past paper questions. O Linked to additional online material for students and teachers, ensuring that you have

as much support as possible. O Revised in colour to engage and motivate students.

Practice Books Edexcel IGCSE Mathematics Practice Books 1 and 2 provide a wealth of exercise and practice material for students preparing for IGCSE Mathematics examinations. O The Practice Books are structured to exactly match the Edexcel IGCSE Mathematics

Books 1 and 2 for Specification A, so they can be used to extend teaching and learning activities in the classroom or as revision aids. Differentiation is enabled through the popular starred and non-starred exercises. O Almost 2,000 questions are provided, including practice examination questions and four

real past papers in Book 2.

order Student Books

Practice Books

Edexcel IGCSE Mathematics Spec A Student Book 1 978 0 435966 91 1 £18.99

Edexcel IGCSE Mathematics Spec A Practice Book 1 978 0 435044 16 9 £6.99

Edexcel IGCSE Mathematics Spec A Student Book 2 978 0 435966 92 8 £18.99

Edexcel IGCSE Mathematics Spec A Practice Book 2 978 0 435044 15 2 £6.99

Edexcel IGCSE Mathematics Spec B Student Book 978 0 435044 10 7 £18.99

Edexcel IGCSE Further Pure Mathematics Student Book Edexcel IGCSE Further Pure Mathematics Student Book provides complete coverage of the 2009 Edexcel IGCSE specification, so you can be sure you and your students have all the material you need.

author Greg Attwood

42

order Edexcel IGCSE Further Pure Mathematics Student Book 978 0 435044 14 5 £18.99

Maths 14–16

Heinemann IGCSE Maths

Endorsed by University of Cambridge International Examinations

Heinemann

IGCSE

$PSF

Fully revised for the Cambridge IGCSE

.BUIFNBUJDT Colin Nye

Holt, Payne, Rayment, Robinson

Heinemann IGCSE Core and Extended Mathematics books cover the latest syllabus and come endorsed by the University of Cambridge International Examinations. Fully endorsed by the University of Cambridge International Examinations. O Adapted for the Cambridge IGCSE syllabus by Colin Nye, with extensive experience of teaching ExamCafé

mathematics, setting and marking international examination papers, syllabus development and IGCSE teacher training.

3DUWRI3HDUVRQ

CD-ROM inside

Endorsed by University of Cambridge International Examinations

O Differentiated Core and Extended Student Books ensure complete relevance and provide

Heinemann

IGCSE

&YUFOEFE

comprehensive coverage of the Extended-level syllabus.

.BUIFNBUJDT

O Free Exam Café CD-ROM included with both Student Books contains revision advice, revision

Colin Nye

Anne Author

Holt, Payne, Rayment, Robinson

exercises for each chapter and interactive exam practice questions with model answers and examiners’ hints, for all four exam papers. O Accompanying Teacher CD-ROM provides editable supplementary core and extended materials for

classroom and home use, plus answers to all the Student Book questions and notes from the examiner. ExamCafé

CD-ROM inside

3DUWRI3HDUVRQ

order Heinemann IGCSE Maths

www.

Heinemann IGCSE Core Mathematics 978 0 435966 85 0 £17.99

For FREE samples of all our IGCSE resources: www.pearsonschools.co.uk/IGCSEmaths.

Heinemann IGCSE Extended Mathematics 978 0 435966 86 7 £16.99 Heinemann IGCSE Mathematics Teacher’s CD 978 0 435966 93 5 £50.00 (+ VAT)

43 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Edexcel GCSE Statistics Edexcel’s own resources for the 2009 GCSE Statistics specification

Written by experts to ensure you have all the support you need to deliver the new specification with confidence.

Maximising Potential

Motivates students

Provides complete planning support

We’ve combined ResultsPlus exam performance data with useful examiner insight to help you understand your students performance.

Engaging, interactive lessons are made easy using dynamic ActiveTeach technology. This powerful, marketleading software provides access to a wide range of interactive resources at your fingertips – great for whole-class teaching!

Following the clear structure of the specification, the ActiveTeach CD-ROM provides everything you need to plan and deliver your lessons in one place. With schemes of work, lesson plans, unparalleled support for controlled assessment and a range of teaching resources, you have everything you need to plan with confidence.

authors Series Editor Keith Pledger Authors Gill Dyer, Jayne Dyer, David Kent, Keith Pledger, Brian Roadnight, Gordon Skipworth.

44

Maths 14–16

Student Books O Written by examiners and experienced teachers. O Practice exam papers for Foundation and Higher, tailored to the 2009 specification. O examzone sections give tips, tests and techniques for exam preparation and the new

controlled assessment.

boxes in the Student Book show students how to build better answers.

Student Book

Sample pages from Edexcel GCSE Statistics Student Book

Clear explanations and worked examples.

Objectives listed for each chapter.

www.

Review exercise at the end of each chapter, with challenge level shown for each question.

For FREE samples of the Student Books - www.pearsonschools.co.uk/ tryedxcelgcsestats.

45 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

ActiveTeach The ultimate front-of-class teaching tool The ActiveTeach CD-ROM contains interactive versions of the GCSE Statistics Student Book and Teacher Guide, PowerPoint presentations linked to lesson plans and worked solutions to all the exam paper questions in the Student Book. Interactive version of the Student Book that lets you zoom in to any part of the page.

Interactive examzone and features ensure exam success.

ActiveTeach CD-ROM GCSE Statistics

eSpec

ResultsPlus

examzone

Find Resources

Settings

Contents

0/ 1 o f 21

Help

Motivate your students using our unique ActiveTeach technology.

Save time planning by using the editable lesson plans.

My Resources

+

Page Resources

Glossary

Sample screen from Edexcel GCSE Statistics ActiveTeach CD-ROM

Glossary of key terms.

Teacher Guide Exceptional teacher support O Designed for skim-reading to save you time. O Includes worksheets and schemes of work. O End-of-chapter tests are provided to monitor progression. O All available as editable Word files on the CD-ROM. O Lesson plans linked to PowerPoints on the ActiveTeach CD-ROM.

order and evaluate Evaluate

Order

The Evaluation Pack contains a copy of the Student Book and sample material from the Teacher Guide.

Edexcel GCSE Statistics Student Book 978 1 846904 54 7 £18.99

Edexcel GCSE Statistics Evaluation Pack 978 1 846908 46 0 £18.99

Edexcel GCSE Statistics ActiveTeach 978 1 846904 56 1 £300.00 (+VAT) Edexcel GCSE Statistics Teacher Guide 978 1 846904 55 4 £105.00

46

Maths 14–16

Edexcel GCSE Mathematics 2006

Edexcel GCSE Maths: Modular Foundation Multiple Choice Practice Book

Edexcel’s market-leading resources for teachers and students provide a complete package of support for the 2006 two-tier GCSE Mathematics specification.

Higher Linear

Core Student and Teacher resources

978 1 405884 64 8

£4.10

Edexcel GCSE Maths Modular Foundation Multiple Choice Pack 978 1 405885 42 3

£34.00

Revision Resources Foundation Aim High 1 (Aiming for Grade C) Student Book 978 1 846901 87 4

£8.75

Aim High 1 (Aiming for Grade C) Teachers Book 978 1 846901 91 1

Topic Tutor Student Book with CD-ROM 978 1 846900 07 5 978 1 846900 08 2

£360.00 (+ VAT)

£21. 50

Edexcel GCSE Maths: Linear Higher ActiveTeach CD-ROM 978 1 903133 93 4

£14.50

Topic Tutor Site Licence CD-ROM

Edexcel GCSE Maths: Linear Higher Student Book and Active Book 978 1 903133 94 1

£32.50

£895.00 (+VAT)

Revision Resources Higher

Edexcel GCSE Maths: Linear Higher Homework Book

Aim High 2 (Aiming for Grade A/A*) Student Book

978 1 903133 91 0

978 1 846901 88 1

£7.25

£8.75

Aim High 2 (Aiming for Grade A/A*)Teachers Book

Edexcel GCSE Maths: Linear Foundation Student Book and Active Book 978 1 903133 90 3

£21.50

£895.00 (+VAT)

Edexcel GCSE Maths: Linear Foundation Homework Book 978 1 903133 87 3

£7.25

978 1 846900 09 9

Edexcel GCSE Maths: Modular Higher Student Book and Active Book 978 1 846901 02 7

Course Companion Teacher CD-ROM

£21. 50

978 1 846901 00 3

978 1 903133 99 6

£4.10

£34.00

£21. 50

Edexcel GCSE Maths: Modular Foundation ActiveTeach CD-ROM

authors

978 1 903133 97 2

Series Editors

Edexcel GCSE Maths: Modular Foundation Teacher File

Trevor Johnson and Tony Clough

978 1 903133 96 5

Authors/Senior Examiners

Edexcel GCSE Maths: Modular Foundation Homework Book 978 1 903133 95 8

£7.25

£110.00

£7.25

Edexcel GCSE Maths: Modular Higher Multiple Choice Practice Book

978 1 405885 43 0

£110.00

978 1 846901 63 8

£6.75

Edexcel GCSE Maths: Modular Higher Homework Book

Edexcel GCSE Maths: Modular Higher Multiple Choice Pack

£895.00 (+VAT)

978 1 846901 62 1

£110.00

Edexcel GCSE Maths: Modular Foundation Student Book and Active Book 978 1 903133 98 9

£14.50

Course Companion Student Book with CD-ROM

978 1 405884 65 5

Foundation Modular

£32.50

Topic Tutor Student Book with CD-ROM

Edexcel GCSE Maths: Modular Higher Teacher File

Edexcel GCSE Maths: Linear Foundation ActiveTeach CD-ROM 978 1 903133 89 7

978 1 846901 92 8

Higher Modular

Foundation Linear

For mor on E e inform dex at www 2006 R cel GCS ion E eso .p edex earsons urces: c cel2 006 hools.co gcse mat .uk/ hs.

Rob Summerson and Kevin Tanner Authors Julie Bolter and Michael Flowers

47 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 14–16

Edexcel

d l

'PVOEBUJPO

Edexcel

NBUJDT ($4&.PEVMBS ($4&.4BUQFFIF E3FWJTJPO(VJEF .BUIFNBUJDT 4QFFE3 ($4&.PEVMBS.BUIFNBUJDT 4QFFE 3FWJ J

QFFE3FWJTJPO ($4& .BUIFNBUJDT4

Edexcel

)JHIFS

FWJTJPO(VJEF

) I

'PVOEBUJPO

Free CD for extra practice

Free CD for extra practice

Heinemann Edexcel GCSE Mathematics Written by an experienced author team, including senior examiners, Edexcel GCSE Mathematics provides everything students need to help them achieve their full learning potential.

Student and Teacher Resources

Modular Foundation 978 0 435585 27 3

Foundation Student Book (1 & 2) 978 0 435534 08 0

£19.99

£8.50 £8.50

Foundation Student Book Unit 3 978 0 435585 29 7

Series Editor Keith Pledger

Linear Foundation Book

Foundation Student Book Unit 2 978 0 435585 28 0

Gareth Cole, Peter Jolly, Graham Newman, Joe Petran, Sue Bright

4 Speed Revision Guides

Foundation Student Book Unit 1

Linear Foundation

authors

£12.50

978 0 435533 76 2

£8.25

Linear Higher Book 978 0 435533 74 8

£8.25

Modular Foundation Book 978 0 435807 18 4

£8.25

Modular Higher Book 978 0 435807 17 7

£8.25

Foundation Student Book 1 978 0 435536 18 3

£14.50

Foundation Student Book 2 978 0 435536 19 0

£14.50

Modular Higher

Practice Books Foundation Practice Book

Higher Student Book Unit 1 978 0 435585 30 3

Linear Higher


Higher Student Book (1 & 2) 978 0 435534 09 7

£8.50

£19.99

£8.50


£12.50

£14.50

Higher Student Book 2 978 0 435533 66 3

£14.50

Teaching and Learning Software Edexcel GCSE Mathematics Teaching and Learning Software 978 0 435533 75 5

£425.00

978 0 435533 77 9

48

£70.00

Higher Practice Book 978 0 435533 63 2

£7.25

Practice Book (10 Pack) £70.00

Upgrade Online Subscription Edexcel GCSE Mathematics Upgrade Online Subscription First Year 978 0 435210 40 3

5L^YLZV\YJLZMVY.*:, :LLWHNLZ¶

£7.25

Foundation Practice Book (10 Pack)

978 0 435533 78 6

Higher Student Book 1 978 0 435533 65 6

978 0 435533 62 5

First Year £325.00

Maths 14–16

authors

Longman AQA GCSE Mathematics 2006

Series Editor

Written for the 2006 Specifications

Tony Fisher, Sandra Burns and Shaun Proctor-Green

Trevor Senior

Foundation Linear

Foundation Modular

Higher Linear

Higher Foundation Modular

AQA GCSE Maths: Linear Foundation Student Book and Active Book

AQA GCSE Maths: Modular Foundation Student Book and Active Book

AQA GCSE Maths: Linear Higher Student Book and Active Book

AQA GCSE Maths: Modular Higher Student Book and Active Book

978 1 405816 28 1

978 1 405818 50 6

978 1 405816 33 5

978 1 405818 55 1

£21.50

£21. 50

£21.50

£21.50

AQA GCSE Maths: Linear Foundation ActiveTeach CD-ROM

AQA GCSE Maths: Modular Foundation ActiveTeach CD-ROM

AQA GCSE Maths: Linear Higher ActiveTeach CD-ROM

AQA GCSE Maths: Modular Higher ActiveTeach CD-ROM

978 1 405815 82 6

978 1 405818 51 3

978 1 405816 31 1

978 1 405818 56 8

£920.00

£895.00

£895.00

£895.00

AQA GCSE Maths: Modular Foundation Teacher File

AQA GCSE Maths: Linear Higher Teacher File

AQA GCSE Maths: Modular Higher Teacher File

978 1 405818 52 0

978 1 405816 34 2

978 1 405818 57 5

£110.00

£110.00

£110.00

40b AQA GCSE Maths: Modular Foundation Homework book

AQA GCSE Maths: Linear Higher Homework Book

AQA GCSE Maths: Modular Higher Homework Book

978 1 405818 48 3

978 1 405816 30 4

978 1 405818 53 7

£7.25

£7.25

£7.25

Mathematics for AQA GCSE 2006 Providing thorough, comprehensive support to enable every student to achieve their full potential.

Linear Foundation

Linear Higher

Main Text 978 1 405831 39 0

Modular Foundation

Main Text £16.50

Modular Higher

Main Text

978 1 405831 43 7

£16.50

Main Text

978 1 405831 38 3

£16.50

978 1 405831 42 0

£16.50

Student Support Book (with answers)




978 1 405834 91 9

978 1 405834 93 3

978 1 405834 95 7

978 1 405834 97 1

£8.75

£8.75

£8.75

£8.75

Student Support Book (without answers)




978 1 405834 90 2

978 1 405834 92 6

978 1 405834 94 0

978 1 405834 96 4

£7.25

£7.25

£7.25

Mathematics for Edexcel GCSE 2006

Mathematics for OCR GCSE 2006

Foundation

Foundation

Higher

Main Text 978 1 405831 40 6

Main Text £16.50

978 1 405831 44 4

Higher Tier

Main Text £16.50

£7.25

Main Text

978 1 405831 41 3

£16.50

978 1 405831 45 1

£16.50





978 1 405834 99 5

978 1 405835 01 5

978 1 405835 03 9

978 1 405835 05 3

£8.75

£8.75

£8.75

£8.75





978 1 405834 98 8

978 1 405835 00 8

978 1 405835 02 2

978 1 405835 04 6

£7.25

£7.25

£6.99

£7.25

49 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 16+

Edexcel AS and A Level Modular Mathematics Edexcel’s own course for the latest specification author Series Director Keith Pledger

www. Download FREE sample material! www.pearsonschools.co.uk/ tryedexcelasalevelmodmaths

This best-selling series provides the ideal match to supporting the specification. Publishing for all modules, these print and digital resources will motivate your students by making maths easier to learn. O Stimulating, visual chapter openers underline the

importance of mathematics in the real world. O Student-friendly worked examples and solutions,

O Sample exam papers and regular review sections

consolidate learning and provide thorough exam preparation. O Free LiveText CD-ROM with every Student Book,

containing Exam Café and Solutionbank for thorough exam preparation. O Revision Guides for complete exam preparation.

leading to a wealth of practice questions.

course structure AS

Core Mathematics 1 Core Mathematics 2 with LiveText CD-ROM

Statistics 1 with LiveText CD-ROM

Decision Mathematics 1 with LiveText CD-ROM

Mechanics 1 with LiveText CD-ROM

Further Pure Mathematics 1 with LiveText CD-ROM

Revision Book for popular units

A2

Core Mathematics 3 Core Mathematics 4 with LiveText CD-ROM

50

Statistics 2, Statistics 3 & Statistics 4 with LiveText CD-ROM

Further Pure Decision Mathematics 2 Mechanics 2, with LiveText CD-ROM Mechanics 3, Mechanics 4 Mathematics 2 & Further & Mechanics 5 Pure Mathematics 3 with LiveText CD-ROM with LiveText CD-ROM

Revision Books for popular units

Maths 16+

Student Books Making maths easier to learn Available for all modules, these Student Books are written by senior examiners and feature:

Stimulating, visual chapter openers that underline the importance of mathematics in the real world.

Concise key learning points for continual revision.

Student Book CHAPTER

Probability

5

5.1 •

Understanding the vocabulary used in probability.

Draw two axes to indicate the values on each spinner.

If you want to predict the chance of something happening in the future, you use probability. ◦ An experiment is a repeatable process that gives rise to a number of outcomes. ◦ An event is a collection (or set) of one or more outcomes.

4

5

6

7

8

3

4

5

6

7

2

3

4

5

6

1

2

3

4

5

0

1

The sample space is represented by the 16 points on the diagram.

There are 4 ⫻ 4 ⫽ 16 points. Each of these points is equally likely as the spinners are fair.

◦ A sample space is the set of all possible outcomes of an experiment. •

Events and sample spaces are sets and set notation is used to describe them. We use upper case letters to denote events. The probability of an event is the chance that the event will occur as a result of an experiment.

Spinner 2

◦ Where outcomes are equally likely the probability of an event is the number of outcomes in the event divided by the total number of possible outcomes in the sample space. ◦ An impossible event has probability 0 and an event that is certain has probability 1. ◦ As all events have probabilities between impossible (0) and certain (1), then probabilities are usually written as a fraction, a decimal or sometimes as a percentage. In S1 we will write probabilities as fractions or decimals.

a Find the probability of the die landing with the number 5 face up.

There are four 5s and 16 outcomes altogether, so 4 ⫽ __1 P(F)⫽ ___ 16 4

b

6 ⫽ __ 3 P(More than 5) ⫽ ___ 16 8

b Find the probability of throwing an odd number.

a

There are six faces and one has the number 5 on it, so the probability of landing with the number 5 face up 1 or 0.16. . is __ 6

b

The odd numbered faces are 1, 3 and 5, so the probability of throwing 3 ⫽ __1 or 0.5. an odd number is __ 6 2

The sample space has six outcomes since any one of the numbers 1, 2, 3, 4, 5 or 6 could land face up. The die is fair, so all outcomes are equally likely.

You can use F to represent the event ‘the sum of the scores is exactly 5’.

4

a Example 1 A fair die has each face numbered 1 to 6. The die is thrown once and the number landing face up is recorded.

3 2 Spinner 1

There are 4 outcomes for this part. They are 1 ⫹ 4, 2 ⫹ 3, 3 ⫹ 2 or 4 ⫹ 1.

P( ) is short for ‘probability of’. The answer P(F) can also be written as 0.25.

There are six sums more than 5 for this part (shaded blue). They form the top right hand corner of the diagram: 2 ⫹ 4, 3 ⫹ 4, 4 ⫹ 4, 3 ⫹ 3, 4 ⫹ 3, 4 ⫹ 2. The answer can also be written as 0.375.

Exercise 5A For each of the following experiments, identify the sample space and find the probability of the event specified.

There is one outcome in the event ‘5 is face up’ divided by the total of six possible outcomes.

1

Throwing a six sided die once and recording if the number face up is odd or even. Find the probability of an even number landing face up.

The event ‘throwing an odd number’ has three outcomes i.e. 1, 3 or 5 face up.

2

Tossing two coins. Find the probability of the same outcome on each coin.

3

A card is drawn from a pack of 52 playing cards. Find the probability that the card is a heart.

4

A card is drawn from a pack of 52 playing cards, its suit is recorded then it is replaced and another card is drawn. Find the probability of drawing a spade and a club in any order.

5

Throwing a die and tossing a coin. Find the probability of a head and a 6.

6

Throwing two six sided dice and recording the product of the values on the two sides that are uppermost. Find the probability of the answer being greater than or equal to 24.

There are three outcomes divided by the total of six possible outcomes.

Example 2 Two fair spinners each have four faces numbered 1 to 4. The two spinners are thrown together and the sum of the numbers indicated on each spinner is recorded. Find the probability of the spinners indicating a sum of a exactly 5, b more than 5. 78

79

Sample pages from Edexcel AS and A Level Modular Mathematics: Statistics 1 Student Book

Hand-written studentfriendly format makes maths accessible.

Plenty of practice questions consolidate learning.

Student-friendly worked examples and solutions, leading to a wealth of practice questions.

51 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]

w www.pearsonschoolsandcolleges.co.uk

Maths 16+ Student Book

Statics of a particle

4

`Static' means `stationary' or àt rest', and this chapter looks at the forces acting on a particle that is not moving. Later in this chapter the various types of forces that may act on a particle will be considered. At this point you only need to remember from chapter 2 that you can describe a force acting on a particle by stating its magnitude and its direction. 92

Forces are measured in newtons. The precise definition of a newton is given in chapter 5 (p. 92). A force of magnitude of 8 newtons is usually written 8 N.

4.1 Resultant forces Suppose two forces F1 and F2 act on a particle as shown. As forces are vectors they may be added by the triangle law (see p. 15) You can redraw the diagram as: F2

Dynamics of a particle moving in a straight line or plane

Mass is measured in kilograms (kg) and the basic unit of force is the newton (N). The newton is defined so that a force of 1 newton produces an acceleration of 1 m s 2 when applied to a particle of mass 1 kg. A force of F newtons applied to a particle of mass m kg will result in an acceleration of a m s 2 where:

F2

F ma F1

R

Force and acceleration are vectors because each has a magnitude and a direction. Therefore the acceleration produced is in the direction of the resultant force acting on the body. Newton's second law can be summarised by the equation F m a. This is often called the equation of motion of the particle.

F1

Then R F1 F2 is the resultant of the two forces. Use a double arrow to indicate that R is a resultant force rather than a third force acting on the particle.

&

The force F applied to a particle is proportional to the mass m of the particle and the acceleration produced.

Another way of adding forces is to use the parallelogram rule. (See p. 15).

F ma

F2

Newton's third law R &

Every action has an equal and opposite reaction.

This means that if a particle A exerts a force on a particle B then B exerts a force on A of the same magnitude but in the opposite direction. These equal and opposite forces are known as reactions between the particles. Newton's third law is also true when two bodies which are not both particles have contact. This law is used when studying normal contact forces ± as in chapter 4. A particle at rest on the floor exerts a force on that floor. The floor also exerts a force of equal magnitude but opposite direction on the particle and the particle remains at rest.

F1

Sample pages from Edexcel AS and A Level Modular Mathematics: Mechanics 1 Student Book

Floor exerts force on particle

Review exercise 2 155

42

A

Particle exerts force on floor

2h

P

3m h B

m h

Particles A and B, of mass 3m and m respectively, are attached to the ends of a light inextensible string of length 3h. The string passes over a small, smooth pulley P, fixed at the edge of a rough, horizontal table. The coefficient of friction between A and the table is m. The system is held at rest with the string taut, A being on the table and B hanging freely over the edge of the table. The distances AP and PB are 2h and h respectively, and B is at height h above a horizontal floor, as shown in the diagram. The system is now released from rest and begins to move. (a) Show that, until B hits the floor, the acceleration of A is 1 3m)g. 4 (1 (b) Find the speed of A immediately before B hits the floor. After B hits the floor, A continues to move on the table and comes to rest before reaching P. (c) Deduce the range of values of m for which the motion described above is possible. [E] 43 A small sphere R, of mass 0.08 kg, moving with speed 1.5 m s 1 , collides directly with another small sphere S, of mass 0.12 kg, moving in the same direction with speed 1 m s 1 . Immediately after the collision R and S continue to move in the same direction with speeds U m s 1 and V m s 1

52

Review exercises including past paper questions.

Maths 16+

FREE LiveText CD-ROM with every Student Book! Increasing student motivation Every Student Book comes with an exclusive FREE LiveText CD-ROM, containing an array of tools to support students and help them to prepare thoroughly for their exams. O Digital version of the textbook allows for quick and easy access to the theory. O Solutionbank provides fully worked solutions, hints and tips for every question in the

Student Book. Relaxed and friendly atmosphere puts students at ease.

O Exam Café contains a wealth of interactive exam preparation material and guidance,

to motivate students and help them prepare for their exams.

Exam Café

Content checklist guides revision.

Exam questions, model answers and examiners’ tips provide full exam support.

Sample screens from Edexcel AS and A Level Modular Mathematics: Statistics 1 FREE LiveText CD-ROM

Handy revision advice from examiners.

www. Visit our Exam Café mini-site to see how this new learning environment could work for your students: www.examcafe.co.uk.

Fully worked examination style paper with examiner’s commentary, for full exam preparation.

53 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths 16+

Revision Guides Focused exam preparation Help your students push for the top grades with these focused Revision Guides! Ideal for use alongside the Student Books, they provide practice questions, worked examples, an exam-style paper, and an array of examiners’ hints and tips for complete exam preparation. Available for: O Core Mathematics 1–4 (C1 to C4) O Statistics 1 (S1) O Mechanics 1 (M1)

Revision Guides

3

Equations Equations and and inequalities inequalities What you should know 1 2

3 4

Worked exam-style questions and examples provide step-by-step guidance on how to tackle questions.

You can solve simultaneous equations by elimination or substitution. You can use the substitution method to solve simultaneous equations where one equation is linear and the other is quadratic. You usually start by finding an expression for x or y from the linear equation. When you multiply or divide an inequality by a negative number, you need to change the inequality sign to its opposite. To solve a quadratic inequality you: (i) solve the corresponding equation, then (ii) sketch the graph of the quadratic function, then (iii) use your sketch to find the required set of values.

Test yourself

What to review If your answer is incorrect

1

Find the coordinates of the point of intersection of the lines with equations y ⫽ 6x ⫺ 5 and 4x ⫺ 3y ⫽ 8

Review Edexcel Book C1 pages 28–29 Revise for C1 page 14 Example 1

2

Solve the simultaneous equations

Review Edexcel Book C1 pages 30–31 Revise for C1 15 58 page Integration Worked examination style question 1 Example 2 Review Edexcel Book C1 5 Find 3兹x苶 ⫹ ᎏᎏ3 dx pages 32–34 x Revise for C1 page 16 Worked examination style 1 5 question 2 3兹x苶 ⫹ ᎏᎏ3 dx ⫽ (3 (3xx 2 ⫹ 5x⫺3) dx dx x Review Edexcel Book C1 3 pages 35–37 x⫺2 x2 ⫽ 3ᎏ 3 ⫹ 5ᎏ ⫹ c Revise for C1 page 16 ᎏᎏ ⫺2 2 Worked examination style 3 question 3 5 ⫺2 2 ᎏ ᎏ ⫽ 2x ⫺ 2 x ⫹ c

y ⫺ 2x ⫽ 5 y2 ⫺xy ⫺x2 ⫽ 11 3

Find the set of values of x for which 2x ⫺ x(x ⫹ 5) ⬍ x(1 ⫺ x) ⫺ 6

4

Find the set of values of x for which 2x2 ⫺ x ⫺ 28 ⬎ 0

冕冢

冕冢

冣

冕

冣

Using 4 : first write each term in the form kxn.

Using 3 : integrate each term.

Finally, simplify each term.

Worked examination style question 1

Find

Sample page from Edexcel AS and A Level Modular Mathematics: Revise for Core Mathematics 1

冕(x ⫹ 2兹x苶 ) dx 2

冕(x ⫹ 2兹x苶) dx ⫽ 冕(x ⫹ 4x 2

2

3 2

⫹ 4x) dx dx

Using 4 : write the expression in a suitable form to integrate. First square the bracket.

5

x3 x2 x2 ⫽ ᎏ ⫹ 4ᎏ ⫹ 4ᎏ ⫹ c ᎏ5ᎏ 3 2 2 3

x 8 ⫽ ᎏ ⫹ ᎏᎏ x ⫹ 2x2 ⫹ c 5 3

Using 3 : integrate term by term.

5 2

Simplify.

Worked examination style question 2 12 dy The curve C with equation y ⫽ f( f(xx) is such that ᎏᎏ ⫽ 3兹x苶 ⫹ ᎏ , x ⬎ 0 兹x苶 dx The curve C passes through the point (4, 30). Using integration, find f( f(xx).

冕冢3兹x苶 ⫹ ᎏ兹12ᎏ苶x 冣 dx ⫽ 冕(3(3xx

1 2

⫹ 12 12xx

3 2

1

⫺2

) dx dx

So

x x y ⫽ 3ᎏ ⫹c 1 3 ⫹ 12 ᎏ

So

y ⫽ 2x 2 ⫹ 24 24xx 2 ⫹ c

ᎏᎏ 2

ᎏᎏ 2

3

1

Using (4, 30), 30 ⫽ 2 ⫻ 23 ⫹ 24 ⫻ 2 ⫹ c So

c ⫽ 30 ⫺ 16 ⫺ 48 ⫽ ⫺34 ⫺34 3

and

54

Integrate to find y. Using 4 : write each term in the form xn.

1 2

1

f(xx) ⫽ 2x 2 ⫹ 24 f( 24xx 2 ⫺ 34

Using 6 : find c. 3 Remember that 4 2 is 23.

Maths 16+

www. Visit www.pearsonschools.co.uk/rpb for more information.

ResultsPlus Booster for GCE new! Mathematics ResultsPlus Booster for Edexcel GCE Mathematics is an innovative online learning and assessment tool built on technology that is used by millions worldwide. Designed for those taking Edexcel GCE Maths, ResultsPlus Booster provides supportive but challenging auto-marked questions along with guidance on exam questions. This will help focus on the problem areas, allowing your students to maximise their potential. O Guided practice questions with learning aids and targeted feedback that allow students

to overcome their own difficulties independently. In addition to this, a study plan allows for independent learning and updates automatically to show students what they need to focus on. O Constantly updated bank of questions based on recent exam data maximises students’

chance of achieving their target grade. O For those who work quickly or who need extra practice, dynamically generated questions

mean that can continue to practise without input from the teacher. O Auto-marking of questions allows you to spend time teaching, rather than marking. O Clear reporting through individual study plan results, allows you to highlight areas of

weakness and work with the student to target these areas.

ordering details Student Books with FREE LiveText CD-ROM Core Mathematics Core Mathematics 1 (C1) 978 0 435519 10 0 £13.50 Core Mathematics 2 (C2) 978 0 435519 11 7 £13.50 Core Mathematics 3 (C3) 978 0 435519 09 4 £13.50 Core Mathematics 4 (C4) 978 0 435519 07 0 £13.50

Statistics Statistics 1 (S1) 978 0 435519 12 4

£13.99

Statistics 2 (S2) 978 0 435519 13 1

£13.99

Statistics 3 (S3) 978 0 435519 14 8 Statistics 4 (S4) 978 0 435519 15 5

Mechanics

Revision Guides

Mechanics 1 (M1) 978 0 435519 16 2

£13.99

Revise for Core Mathematics 1 (C1) 978 0 435519 26 1 £6.50

Mechanics 2 (M2) 978 0 435519 17 9

£13.99


Mechanics 3 (M3) 978 0 435519 18 6

£13.50


Mechanics 4 (M4) 978 0 435519 24 7

£13.50


Mechanics 5 (M5) 978 0 435519 25 4

£13.50

Revise for Statistics 1 (S1) 978 0 435519 30 8 £6.50

Decision Mathematics Decision Mathematics 1 (D1) 978 1 846908 93 4 £13.99

Revise for Mechanics 1 (M1) 978 0 435519 32 2 £6.50

ResultsPlus Booster for GCE

Decision Mathematics 2 (D2) 978 0 435519 20 9 £13.50

ResultsPlus Booster for GCE - Single User Login 978 1 446900 01 7 £14.99* (+VAT)

£13.99

Further Pure Mathematics

ResultsPlus Booster for GCE - Login Pack 978 1 446900 00 0 £129.99* (+VAT)

£13.99

Further Pure Mathematics 1 (FP1) 978 0 435519 23 0 £13.99 Further Pure Mathematics 2 (FP2) 978 0 435519 21 6 £13.99

* Prices are provisional until publication.

Further Pure Mathematics 3 (FP3) 978 0 435519 22 3 £13.50

55 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]

w www.pearsonschoolsandcolleges.co.uk

Maths 16+

Longman Advanced Mathematics The most supportive texts for AS and A2 Core Maths Longman Advanced Mathematics is a series of comprehensive texts, with books for the current AQA, OCR and Edexcel core for AS and core for A2. The series develops mathematical skills through clear and thorough explanations, and comes packed with worked examples and progressive exercises. It also includes focused exam question practice and sample module papers. A CD-ROM included with every book, contains fully worked solutions to exam-style papers using Live Authoring, plus additional questions and support for lower - and higher - attaining students.

ordering details Advanced Maths for AQA

Advanced Maths for OCR

Advanced Maths for Edexcel

AS Core Student Book 978 0 582846 31 9 £22.50



A2 Core Student Book 978 0 582842 40 3 £22.50



Advanced Maths Essentials Focused revision materials O Provides useful strategies for answering each type of question. O Detailed examples strengthen understanding and application. O Includes a FREE CD-ROM providing useful examiner tips and sample exam papers.

ordering details authors Rosemary Emanuel John Wood Janet Cranshaw

Advanced Maths Essentials for AQA

Advanced Maths Essentials for OCR

Advanced Maths Essentials for Edexcel

Core 1 for AQA 978 0 582836 77 8

£9.25

Core 1 for OCR 978 0 582836 49 5

£9.25

Core 1 for Edexcel 978 0 582836 63 1

£9.25

£9.25

Core 2 for OCR 978 0 582836 52 5

£9.25

Core 2 for Edexcel 978 0 582836 66 2

£9.25

£9.25

Core 3 for OCR 978 0 582836 55 6

£9.25

Core 3 for Edexcel 978 0 582836 69 3

£9.25

£9.25

Core 4 for OCR 978 0 582836 58 7

£9.25

Core 4 for Edexcel 978 0 582836 72 3

£9.25

Core 2 for AQA 978 0 582836 80 8 Core 3 for AQA 978 0 582836 83 9 Core 4 for AQA 978 0 582836 86 0

Mechanics 1 for AQA 978 0 582836 89 1 £9.25

Mechanics 1 for OCR 978 0 582836 61 7 £9.25

Mechanics 1 for Edexcel 978 0 582836 75 4 £9.25

Statistics 1 for AQA 978 0 582836 90 7

£9.25

Decision 1 for OCR* 978 1 405818 47 6

Decision 1 for Edexcel 978 1 405818 46 9 £9.25

Decision 1 for AQA* 978 1 405818 45 2

£9.25

*CD-ROM not included with Decision 1 book.

56

£9.25

Maths 16+

Advancing Maths for AQA 2nd Edition Everything you need for AQA exam success Including core textbooks, revision guides and CD-ROM Solutionbanks, this series is written by a team of senior examiners to provide thorough preparation for the revised 2004 specifications for AS and A Level Maths and AS Statistics. O The student-friendly, accessible approach eases transition from GCSE to AS, then up to A Level. O Flexible support includes clear explanations, detailed worked examples and self-assessment tests. O Includes features such as test-yourself sections and key point summaries at the end of each chapter. O The CD-ROM Solutionbanks provide a complete set of solutions to the questions in the textbooks. O The Revision Guides contain all the help, guidance and support your students need. O The Core Books are suitable for the International Baccalaureate Diploma.

ordering details Advancing Maths for AQA Pure Core 1 & 2 2nd Edition (C1 & C2) 978 0 435513 30 6 £20.50 Pure Core 3 & 4 2nd Edition (C3 & C4) 978 0 435513 31 3 £20.50 Further Pure 1 2nd Edition (FP1) 978 0 435513 34 4 £12.50 Decision 1 978 0 435513 35 1

£11.50

Advancing Maths for AQA Revision Guides Pure Core Maths 1 978 0 435513 56 6

£6.99

Pure Core Maths 2 978 0 435513 57 3

£6.99

Pure Core Maths 3 978 0 435513 58 0

£6.99

Pure Core Maths 4 978 0 435513 59 7

£6.99

Mechanics 1 (M1) 978 0 435513 36 8

£11.50

Mechanics 2 (M2) 978 0 435513 37 5

Statistics 1 978 0 435513 55 9

£6.99

£12.50

Mechanics 1 978 0 435513 52 8

£6.99

Statistics 1 (S1) 978 0 435513 38 2

£11.50

Statistics 2 (S2) 978 0 435513 39 9

£12.50

Advancing Maths for AQA Solutionbank Pure Core Maths 1+2 (C1+C2) Network Edition 978 0 435513 47 4 £320.00 Mechanics 1 (M1) Network 978 0 435513 49 8 £210.00 Statistics 1 (S1) Network Edition 978 0 435513 51 1 £210.00

Advancing Maths for AQA Solutionbank Student Editions Pure Core Maths 1+2 (C1+C2) Student Edition 978 0 435513 43 6 £24.00 Mechanics 1 (M1) Student Edition 978 0 435513 48 1 £12.99 Statistics 1 (S1) Student Edition 978 0 435513 50 4 £12.99

Statistics 2 & 3 (SS2 & SS3) 978 0 435513 40 5 £19.50

57 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


Maths Scotland S5

Best-sellers for success in Higher Mathematics

Written by an experienced team of Scottish authors and examiners, these best-selling books provide full support for the new objective questions exam paper and will help students achieve the best grade in the Higher Mathematics examination. Student Book

Topic summaries highlight key points and act as useful revision tools.

Revision Guide 1UADRATICFUNCTIONS

"LiVÌÛiÊµÕiÃÌÃ 7HENXXISWRITTENINTHEFORMXP Q lNDTHE VALUESOFPANDQ

authors

P !

David Clarke John Dalton Carole Ford Douglas Goodall Jim Pennel Tom Sanaghan

Clearly highlighted revision exercises and examples show students whether they are preparing for a unit test of for the whole course exam.

Q

"

#

$

4HEDIAGRAMSHOWSTHEGRAPHOFTHEFUNCTIONFWHERE FX PXQ R 4HELINEXISANAXISOFSYMMETRYOFTHECURVE 7HICHOFTHEFOLLOWINGISTRUEABOUTP QANDR

! " # $

‘Test-yourself’ questions present opportunities for self-assessment.

P Q R P Q R P Q R P Q R

&ORTHEEQUATIONXX WHATISTHENATUREOFITSROOTS ! %QUALROOTS " 4HREEDISTINCTROOTS # 4WODISTINCTROOTS $ .OREALROOTS

Sample page from Heinemann Higher Mathematics Student Book, Second edition

Plenty of practice questions and worked examples help consolidate learning and prepare students for the exam.

Each chapter includes a section on objective questions, providing full support and preparation for the new-style exam paper.

58

!PARABOLAHASEQUATIONYXX7HATARETHECOORDIANTES OFTHETURNINGPOINT ! " # $

/iÃÌÊÞÕÀÃiv 5 5SETHEDISCRIMINANTTODETERMINETHENATUREOFTHEROOTS OFTHEEQUATIONXX

7>ÌÊÌÊÀiÛiÜ )FYOURANSWERISINCORRECT 2EVIEW(EINEMANN(IGHER -ATHEMATICS#HAPTER PAGE

ordering details Sample pages from Revise for Heinemann Higher Mathematics, Second edition

Heinemann Higher Mathematics Student Book, Second edition 978 0 435516 22 2 £18.99 Revise for Heinemann Higher Mathematics, Second edition 978 0 435516 23 9 £8.75

Maths Scotland S5

Scottish Secondary Mathematics for S1 and S2 Building all your students’ confidence Scottish Secondary Mathematics provides fully differentiated preparation for Standard Grade and essential support for students heading towards Credit Level. O Fully differentiated and well-structured Student Books feature plenty of contextualised examples

to show pupils how maths relates to the real world. O Teacher’s Resource Files for S1 and S2 contain homework sheets, grids mapping the Student Book

authors

to the 5–14 guidelines and other invaluable resources to provide you with unrivalled support in your teaching.

John Dalton Carole Ford Carol Munro Jim Pennel Tom Sanaghan Elaine Walker

Scottish R3 SECONDARY

Student Books S1 to S4

MATHEMATICS

O Scottish Secondary Mathematics for S1 and S2 stretches and challenges high-ability students and

provides support and consolidation for the less able. O Our Student Books for S3 and S4 are fully in line with the ethos of Curriculum for Excellence and will

provide your students with everything they need to head towards Credit Level. Tom Sanaghan Jim Pennel Carol Munro Carole Ford John Dalton Elaine Walker

Whiteboard Toolkit for S1 to S4 This bank of exciting resources will engage all students from S1 to S4. Easy to use and designed to operate on your VLE, it consolidates students’ learning and boosts exam success.

ordering details

authors Phil Marshal Crawford Craig

Scottish Secondary Mathematics Student Books

Scottish Secondary Maths Red 2 978 0 435040 15 4 £14.99

Scottish Secondary Mathematics Teacher’s Resource File

Scottish Secondary Maths Red 1 978 0 435040 11 6 £14.99

Scottish Secondary Maths Blue 2 978 0 435040 14 7 £14.99

Scottish Secondary Maths Blue 1 978 0 435040 12 3 £14.99

Scottish Secondary Maths Green 2 978 0 435040 16 1 £14.99

Scottish Secondary Maths S1 Teacher’s Resource File 978 0 435040 18 5 £85.00

Scottish Secondary Maths Green 1 978 0 435040 13 0 £14.99

Scottish Secondary Maths Red 3 978 0 435040 56 7 £15.99 Scottish Secondary Maths Red 4 978 0 435040 57 4 £15.99

Scottish Secondary Maths S2 Teacher’s Resource File 978 0 435040 17 8 £85.00

Scottish Secondary Mathematics Whiteboard Toolkit Scottish Secondary Mathematics Whiteboard Toolkit for S1–S4 978 0 435040 65 9 £210.00 (+VAT)

59 t 0845 630 33 33

f 0845 630 77 77

@ [email protected]


International Baccalaureate

Pearson Baccalaureate Mathematics for the IB Diploma Developed specifically for IB Diploma Mathematics Standard Level and Mathematical Studies Two comprehensive course books covering everything you need to study for the IB Diploma in Mathematics at Standard Level and Mathematical Studies. O Written by Ibrahim Wazir and Tim Garry (SL) and Ron Carrell and David Wees (Studies); all highly

experienced IB teachers, workshop leaders and examiners. O Include worked examples with effective illustrations to show students how to work out tricky

questions, and hint boxes highlighting the best routes to solutions. O Offers exam-style assessment opportunities with past-paper questions and Portfolio support. O Include an innovative Theory of Knowledge (TOK) chapter and clear links to TOK throughout. O Complete worked solutions CDs!

Higher Level A comprehensive course book covering the Core material, the Additional Higher Level material and all the Options for the IB Diploma in Mathematics at Higher Level*. O Written by Ibrahim Wazir and Tim Garry, both highly experienced IB teachers, workshop leaders

and examiners. O Provides guidance on the Internal Assessment and the Extended Essay. O Includes worked examples with effective illustrations to show students how to work out tricky

questions, and hint boxes highlighting the best routes to solutions. O Offers exam-style assessment opportunities with past-paper questions. O Includes an innovative Theory of Knowledge chapter and clear links to TOK throughout. O Complete worked solutions CD.

www. For more information and full contents listing for these titles, please visit: www.pearsonbaccalaureate.com

* Options provided online: access to all Mathematics Higher Level Options chapters is provided upon purchase of the Student Book.

ordering details Pearson Baccalaureate Pearson Baccalaureate: Standard Level Mathematics 978 0 435994 23 5 £23.20

60

Pearson Baccalaureate: Higher Level Mathematics 978 0 435994 41 9 £44.99

Pearson Baccalaureate: Mathematical Studies 978 0 435994 31 0 £28.50

Your next step... Your Customer Services Team Secondary 0845 630 33 33 Vocational 0845 630 44 44 [Fax] 0845 313 7777 [email protected] / [email protected]

Customer Services, Pearson Education Ltd, FREEPOST ANG2041, HARLOW, CM20 2BR

Easy ordering Our friendly, well-informed team is ready to take your order. We are open from 8.30am to 5.30pm, Monday to Friday.

Day-to-day enquiries Contact the team for information about publication dates, payment terms, invoices, deliveries and returns. Full details are also available at

Online Support www.pearsonschoolsandfecolleges.co.uk

Easy ordering Visit our secure, easy-to-use website to place your order, see a product on inspection or approval and sign up for free online trials.

Using eProcurement? Our website is compatible with most eProcurement systems, including Capita FMS and the @schools portal. Visit www.pearsonschoolsandfecolleges.co.uk/ eprocurement for details.

You can track outstanding orders, those that have been dispatched to you or inspection copy returns online at ‘myaccount’. To log in you will need your account number, which is printed on your invoice and on the order confirmation email you receive when you order online.

Research new products and see what’s free Access sample pages and demos, contents listings, matching charts and find free resources.

Comments

Our termly email updates are the best way to find out about free materials, special discounts and our latest products. You can register for any of the updates at www.pearsonschoolsandfecolleges.co.uk/signup.

Above contact details apply to UK establishments only.

+44 1279 623925

Pearson Education International Customer Services, Edinburgh Gate, Harlow, Essex, CM20 2JE, UK [email protected] Or contact your local rep www.pearsonglobalschools.com/contact

[email protected]

Vocational 01865 888207

Information, advice and guidance To give you an even better service and to complement our team of Local Consultants, we now have an office-based team to advise on how our resources help meet teaching and learning needs. The team is available to take your calls from 9.00am to 5.00pm, Monday to Friday.

Make the most of your budget Your Local Consultant will be happy to advise the most cost-effective way to adopt the programme in your establishment.

Free presentations Your Local Consultant would be delighted to provide a free presentation of any of our resources at a time convenient to you. This allows you to examine the resources thoroughly, discuss your specific needs and helps you to find the most cost-effective way to buy.

Expert Digital Product Support CD ROMs:

0845 313 88 88 +44 1279 623627

0800 023 2923

[email protected]

eNewsletters

Customers outside the UK

Secondary

Online order tracking

www.pearsonschoolsandfecolleges.co.uk.

We value your suggestions and comments – knowing when we get it right for you will help us get it right for others too!

Your Local Sales Consultant

[email protected] Online Subscriptions:

0845 223 88 24 [email protected]

Advice on getting started Our digital support phone lines are open from 8.30am to 5.30pm, Monday to Friday. The team will be able to help you install, network, trial and use our resources effectively.

Network guidance Contact us for advice on compatibility with your school or college network.

Help with installation Technical help files are provided on all our new software and walk you through the installation process quickly and easily.

Extra support online You can find FAQs, downloadable updates and our technical discussion forum on our website www.pearsonschools.co.uk/digitalsupport.

www.pearsonschoolsandfecolleges.co.uk ...the easy way to shop and save

Save

Save

money with bulk discounts

time with the fast shop

Spend £200 and save 15%. Plus, new this year, spend over £2000 online and save a whopping 20% off!

Want to top up or re-order your resources quickly? Simply type your ISBNs into our fast shop interactive order form and away you go!

Save

Save

on paperwork with orders on account

phone calls with our online services

Order on your school or college account and we’ll send you an invoice with your order we’ll even include your purchase order number.

Track your orders, return evaluation copies or raise invoices online in the myaccount section of the website.

What you’ve been telling us about the website Great, I completed my order in very little time – couldn’t have been easier! Anthony Kelly, Head of Science, St Matthias Park Pupil Referral Unit, Bristol

The best website for ordering I’ve been on. Jacquie Baldwin, Vice Principal, Heathland School, Accrington

I‘m not particularly IT literate, and found navigating your website very easy - thank you for making the process as stress-free as possible!

T1BMATCOF

Terry Clements, Curriculum Manager, Sheffield

!"#

Pearson Education is committed to reducing its impact on the environment by using responsibly sourced and recycled paper.